KEGG   Maylandia zebra (zebra mbuna): 101481723
Entry
101481723         CDS       T02814                                 

Definition
(RefSeq) proepiregulin
  KO
K09784  epiregulin
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101481723
   04012 ErbB signaling pathway
    101481723
SSDB
Motif
Pfam: EGF EGF_2 Laminin_EGF
Other DBs
NCBI-GeneID: 101481723
NCBI-ProteinID: XP_004547014
UniProt: A0A3P9C396
LinkDB
Position
LG12
AA seq 154 aa
MGISKLSVLLSIIGVMMIWPYVLTESASPRVPSADGASLPAGQGEKQQHVVKRSMQNCES
AYDNYCLNNGQCILLVDINEHHCKCETGFIGSRCEKLELVLGPEGEKQIIIIIFFMILLI
IGLAGALYLFCRWYEKNNFRRQLKLQGYKGDEMA
NT seq 465 nt   +upstreamnt  +downstreamnt
atggggatcagcaaactgtcagtgctcctgtcaattatcggtgtcatgatgatctggccg
tatgtactcaccgagagtgcatcacccagagtgccgtctgcagatggtgcttctttgcct
gcaggccagggagaaaagcaacagcatgtggttaagcggtcgatgcagaactgtgaaagc
gcatatgacaactactgtttgaacaacggccagtgcatactgctcgtggacatcaatgaa
caccactgcaagtgtgagacaggcttcattggttccaggtgtgagaaactggaacttgtt
ttggggccagaaggtgaaaagcaaataattatcatcattttcttcatgattctgctgatt
attggattggctggagctctgtaccttttctgcagatggtatgagaagaataattttcga
cgtcagctgaagctgcagggttacaaaggagacgagatggcttag

DBGET integrated database retrieval system