KEGG   Maylandia zebra (zebra mbuna): 101481776Help
Entry
101481776         CDS       T02814                                 

Gene name
tk1
Definition
(RefSeq) thymidine kinase, cytosolic
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00240  Pyrimidine metabolism
mze00983  Drug metabolism - other enzymes
mze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101481776 (tk1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101481776 (tk1)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     101481776 (tk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 ATPase_2 Ribosomal_L40e
Motif
Other DBs
NCBI-GeneID: 101481776
NCBI-ProteinID: XP_004539050
LinkDB All DBs
Position
LG6
AA seq 233 aa AA seqDB search
MNMDCVDFPRVLPNSPRKARGQIQVIFGPMFSGKSTELMRRVRRFQIAQYNCLVIKYAKD
TRYSDTGMATHDKSTMEAVPANCLTDVRPLALRACVIGIDEGQFFPDAVEFCEEMANLGK
TIIVAALDGTFQRKAFGNILNLVPLAESVVKLHAVCMQCFKEAAYTKRIGAEKEVEVIGG
ADKYQAVCRKCYGGLMVDKENSSPFRNETPQNALIGKLVDSGVPRKLFSSLHL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggactgcgtagatttcccaagagtcctaccaaactcaccgaggaaagcccgg
ggacaaattcaggtaatttttggacctatgttttcaggcaaaagcactgaactgatgaga
agagtgcgccgtttccagatagcccagtacaactgcctggtgatcaaatatgccaaagat
acacggtactccgacacgggcatggccactcatgacaaaagcacaatggaagctgtacca
gcaaattgtctgacggatgtgcggcctttggcactacgagcttgtgtgattggaatcgat
gaaggacagtttttcccagatgctgtggagttttgtgaggagatggctaatttggggaag
acaatcattgtagctgccttagatggaaccttccagagaaaggcgtttggaaacatcctg
aaccttgttcctctggcggagagtgtagtgaagctccacgctgtctgcatgcagtgtttc
aaagaagctgcctacaccaagaggataggagctgaaaaggaggtggaagtgattggtgga
gcagacaaatatcaggcggtgtgcagaaagtgttacggaggtctgatggttgacaaagag
aacagttctcccttcaggaacgaaactccacaaaatgccctcataggaaaactcgtggac
agcggtgttcccaggaagctcttctcctctctacacctctga

DBGET integrated database retrieval system