KEGG   Maylandia zebra (zebra mbuna): 101482089
Entry
101482089         CDS       T02814                                 

Definition
(RefSeq) ETS domain-containing protein Elk-1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04510  Focal adhesion
mze04910  Insulin signaling pathway
mze04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101482089
   04012 ErbB signaling pathway
    101482089
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101482089
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101482089
   04912 GnRH signaling pathway
    101482089
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mze03000]
    101482089
Transcription factors [BR:mze03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    101482089
SSDB
Motif
Pfam: Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 101482089
NCBI-ProteinID: XP_004568235
UniProt: A0A3P9DD53
LinkDB
Position
Unknown
AA seq 582 aa
MESNPLINAMDPSITLWQFLLHLLEDQRQRHLISWTSEDGEFKLLDAEEVARLWGLRKNK
HNMNYDKLSRALRYYYDKNIIKKVSGQKFVYKFVSQPDPSLPDGIRSIEEGQRRDVSDSN
NQSKSLGGVAPTCPTKGLPQRSSPSSSQKSSRNDYMKSGLYSTFTIQSLQASPNPRPIKS
ELLLQQEPVPKVDRTPREVCVLPESKSSPSVGSAADSVLQVIVTQTSPCPTPALSPQIPA
NSNGQSQNPPAAPLSDPPQIYLTNMGDPSTLITLGGGTVSPVPPPHVSMGTQGPQQEDCG
GLTNPTNFPSHHPHAAPHQSHPAPVFVIINPPPNQQQQQVPMTTAAPPPSVALPPTARPP
PIVIKEENLPSEQELLEMVTLDGKRVEEVPQLICDSGEPEPPPTIVESPPPPCIDAGVGV
QQPAEEERTEGEGQDTLTDPVIPPVTTSLPVTSPAASSSDAVPPKQKKPRGLELPSSPSL
PPGLSLDKVNAAVNSLLAPGSATNTLTPTVITSHALTPVLLTPSPLPSTIHFWSTLSPIA
PRSPAKLSFQFPSNGSNQIHIPALSVDGLSTPVVLSPGPQKP
NT seq 1749 nt   +upstreamnt  +downstreamnt
atggagtccaacccactgattaacgcgatggacccgtccatcacgctgtggcagttcctg
cttcatctgttggaggaccagcggcagcgtcacctgatctcctggacaagtgaggacggc
gagttcaagctgctagacgccgaggaggtggcccgcctgtgggggctccgcaagaacaag
cacaacatgaactacgacaaactgagccgggcactgagatactactacgacaagaatatc
ataaagaaggtgagcggccagaagtttgtctataagtttgtaagtcagcctgacccctcc
ctccccgatgggatacgcagtatagaggagggccagaggagggacgtcagcgactcaaac
aaccaatcaaaaagccttgggggcgtggcaccaacttgtccgacaaagggcttgccccag
cgctcgtcacccagcagctcccagaagagctccagaaacgactacatgaagtccggcctc
tactccaccttcaccatccaatccctgcaggcctcacccaatccacggccaatcaaatca
gagctcctcctgcaacaagagcctgtccccaaagttgatcgcacaccgagagaggtgtgt
gtgttaccggagtctaaatcctctccgtccgtggggagcgctgcggactctgttctccag
gtcatcgtcactcagacgtctccctgtccgaccccggctctcagcccacagataccagcc
aactccaatggccaatcacagaatcctcctgctgctccgctgagcgaccctccccagatt
tatctcaccaacatgggggacccgtccaccctcatcactctcggagggggcacggtgagc
cccgtcccccctcctcatgtctcaatgggcacacagggcccacagcaggaggattgtggg
ggccttaccaaccccaccaacttcccctcgcaccacccgcatgctgctcctcatcagtct
caccctgcccctgtgttcgttattatcaacccacctcccaatcagcagcagcaacaggtg
ccgatgacgactgctgctcctcctccctctgtcgctcttcctcccaccgcccgtcctcca
cccatcgtcatcaaggaggagaatctgccgtcagagcaggagctgctggagatggtgaca
ctggatgggaaacgggtggaggaggttcctcagctgatctgtgactcgggagagccagag
cctccccccaccattgtggaaagcccgcccccgccctgcattgatgccggggttggagtt
cagcagccagcagaggaggagaggacagagggtgagggccaggacacgctaacagatcca
gtcatccccccggtgacgacgtccttgccggtgacctctccagcagcttcatcctcggac
gccgttcctccgaaacaaaagaagccacgaggcctggagctaccctcctctccctccctg
ccccccggcctctccctcgataaggtgaatgcagcagttaacagtttattggctcctgga
tcagcgaccaacacgctcaccccgactgtcatcacctcccacgccctgactccggtcctg
ttgacgcccagccctcttccctccaccatccacttctggagcacgctcagtcccatcgct
cctcgatcgccagctaaactttccttccagtttccctctaacggcagtaatcagatccac
atcccggctctgagcgtcgacggcctctccacccccgtggtcctctccccggggccccag
aagccctga

DBGET integrated database retrieval system