KEGG   Maylandia zebra (zebra mbuna): 101482712
Entry
101482712         CDS       T02814                                 

Gene name
erbb2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2 isoform X1
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
mze04510  Focal adhesion
mze04520  Adherens junction
mze04530  Tight junction
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101482712 (erbb2)
   04012 ErbB signaling pathway
    101482712 (erbb2)
   04020 Calcium signaling pathway
    101482712 (erbb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101482712 (erbb2)
   04520 Adherens junction
    101482712 (erbb2)
   04530 Tight junction
    101482712 (erbb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101482712 (erbb2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mze04147]
    101482712 (erbb2)
   04090 CD molecules [BR:mze04090]
    101482712 (erbb2)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101482712 (erbb2)
Protein kinases [BR:mze01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   101482712 (erbb2)
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101482712 (erbb2)
CD molecules [BR:mze04090]
 Proteins
  101482712 (erbb2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH EphA2_TM
Other DBs
NCBI-GeneID: 101482712
NCBI-ProteinID: XP_004575038
LinkDB
Position
LG8
AA seq 1311 aa
MRCKNLISVSPRWTRSAGSAQMEAARSLLFVGAVLLGVTGASGREVCRGTDMKLALPSSL
ENHYETLRLLYTGCQVVHGNLEITHLHGNPDLSFLQGIVEVQGYVLVAHVSVSLLPLDSL
RIIRGSQLYNSSYALAVLDNTHAGQGLRTLRLRSLTEILLGAVYIWGNPQLCFPDPQNIN
LTDILDEQNGRAKEHRLQPRPPNCPSCSPACGKRCWGETPQDCQTLTRAKCASGCQRCKG
PLPNDCCHLQCAAGCTGPKDSDCLACRHFNDSGVCKENCPLPTTYDPVTFQSQSNPHGKF
NFGATCVKTCPYNYLALEVACTLSCPPNNQEVVVTQPDGTETQKCDKCEGDCPKVCFGPS
TDNNGVTDSSSSIAVVTPSNVEEFNKCTKIFGSLAFRSESFSWDPAKNTSGLTLEQLSAF
RTLEEITGYLYIDAWPEQWTNLSVFENLKVIRGTMLYKGVFSLAIQNLQIESLGLRSLRS
VSGGLVLIYNNTQLCYTNSLPWQNLLHPTQGPHRIVSHNQDPAVCEKEGNVCHPLCKAGC
WGPGPSQCVSCQTFQRGTECVEQCDLYQGPVREYIDGSKCVACDPQCRPLNGSESCHGPG
AQHCTECRNFQDGEYCVDRCPSGVKGDLHTVWKYSNATGHCLPCKTNCTPPCTVKDEQGC
PIDTRTGPGTSIAAAVGGVVLFIILLALLVFYLRRQKKLKRKETMRRILQEHELVEPLTP
SGASPNQAQMRILKETELKKLRVLGSGAFGTVYKGIWAPDGENVKIPVAIKVLRENTSPK
ANKEILDEAYVMAGVASPYVCRLLGICLTSTVQLVTQLMPYGCLLDYVRENKDRIGSQFL
LNWCVQIAKGMSYLEEVRLVHRDLAARNVLVKNPNHVKITDFGLARLLDIDETEYHADGG
KVPIKWMALESILHRKFTHQSDVWSYGVTVWELMTFGSKPYDTIPARDIPEVLEGGERLP
QPLICTIDVYMIMVKCWMIDPESRPRFKGLVNDFSAMARDPTRYVVIQNDEEMSKCSPVD
SEFYRMLLREDENIGEMILDPEEYLVPNTRKGDEPQANGLSRHQSYRQSRDHSLDMDPSN
TAGPRNLHSSLTGISHAQYPTLTMGASASNSVWPQYPMLARSTSAGGQSDSVFLDAPTDS
HSLAPASPGRYSKDPTFPNGSKDDLETDGWNGFPHPYLHHSLPRRSHAIQNHPLPEYVNQ
EIQDLRPGFPERPSTLPRKSRIDRRLPNGLSSGHSVENPGYLIPVNSTSPAFDNPYYLDL
GPKVIPGAVAGDGPAGLESNGGVTRHMNGFVTPTAENPEYLGLADTWSGHT
NT seq 3936 nt   +upstreamnt  +downstreamnt
atgagatgcaaaaacttaatctctgtttcccccagatggactagaagcgccgggtctgcg
cagatggaggcggcgagaagtttgctgtttgtcggggccgtactgctcggagtgacgggc
gcttcaggcagagaagtctgtcggggtacagacatgaagctggccctgccctccagcctg
gaaaaccactatgagactctgaggctgctttacaccggttgccaggttgttcatggaaac
ttggagattacacacctccatggaaaccctgacctctccttcctgcaggggattgtggag
gtacagggttatgtacttgttgctcatgtttctgtgagcctgttgcccttagacagcctt
cggatcataagaggcagccagttgtacaactccagctacgcgctggctgtgctggataac
actcacgccggtcaggggctgaggacgctccggctacgtagcctcacagagatcctgctg
ggtgcagtgtatatttgggggaacccccagctgtgcttcccagacccccagaacatcaat
ttgacggacatcttggatgagcagaatggccgtgccaaggaacaccgactgcagcctcgg
cctcctaactgtccaagttgttcgcctgcatgtgggaaaagatgctggggagagactcct
caggattgccaaactctgacccgagctaaatgtgcgtctggctgccagcggtgtaaaggt
cctctacccaacgactgctgtcacctgcagtgtgcagctggatgcactggacccaaagac
tcagactgtctggcttgtcgtcacttcaacgacagcggtgtatgtaaagagaactgtcca
ctgcccaccacctatgaccccgtcacgtttcagtcccaatccaacccacatgggaagttt
aactttggagcgacctgtgtcaagacgtgtccttataactatctggcgttggaagtggcc
tgtactttatcttgccccccaaacaaccaggaagttgtcgtcacccaacctgacgggacg
gagacgcagaaatgtgataagtgtgaaggagactgtcccaaagtgtgtttcggcccgagt
acagacaacaatggtgtcaccgacagcagcagcagcatcgccgtagtaacgccttccaat
gtggaggagttcaacaagtgcacgaagattttcggtagcctggccttccgctctgagagc
ttctcatgggatcctgcgaagaacacctcaggcctgactttggagcagctgagtgccttc
aggactctggaggagatcacaggttatctctacattgatgcctggccagaacagtggacc
aacctcagtgtgtttgagaacctgaaggtgatcagaggcacgatgctctacaagggtgtg
ttttcactggccatccagaatctgcaaatcgagtctctcgggttgcggtcgctgcgcagc
gtcagtggaggtttggtcttgatttacaacaacacacagctgtgctacaccaactcactg
ccatggcagaatctcctccatcccacccagggtccgcaccgcatcgtcagccacaaccag
gaccctgcagtctgtgagaaagaggggaatgtttgtcaccccctttgtaaggcgggctgt
tggggtccggggcccagccagtgcgtgtcctgccaaactttccaacgtggcaccgagtgt
gtagagcagtgtgatctctatcaggggcccgtacgtgaatacatagatggatctaagtgt
gttgcctgtgatccacagtgtcgacccctcaatggctcagagtcctgccacgggccgggt
gctcaacattgcacggagtgtcggaatttccaggacggcgagtattgcgtggatcggtgt
cccagtggcgtcaagggcgatctgcatactgtgtggaaatacagcaatgccacgggacac
tgtctgccatgcaagaccaactgcacgccaccctgcactgtgaaggatgaacaaggctgc
cccattgataccaggacaggacctggcacgtccattgcggctgcagtaggtggggtggtg
ctcttcattatcctgctggctctgctggtcttttacttgaggagacagaagaagctaaag
aggaaggagacaatgaggaggatcctgcaggagcacgagctggtggagcctttgacgccg
agtggtgcttcacccaatcaagctcagatgcgtatattgaaagagaccgagctgaaaaaa
ctcagggtgctgggttcgggggcctttggcactgtttacaagggaatttgggctcctgat
ggggaaaatgtgaaaatcccagtggcgattaaggttttgcgtgagaacacctcaccaaaa
gccaacaaagaaatcctcgatgaggcatatgtgatggcgggcgttgccagcccgtacgtg
tgtcgtctcctggggatttgtctcacctctactgtgcagctggtcactcagctgatgccg
tacggctgcctcctcgactacgtcagagagaacaaggaccgcattggttcgcagttccta
ctcaactggtgtgtccagattgccaaggggatgagttacctggaggaggttcgtttggtc
cacagagatttggcagcccgcaatgtcctggtgaagaacccgaatcacgtgaagatcacc
gactttggtctggcccgtctgctcgatatagacgagacggagtatcacgccgatggaggg
aaggtgccaatcaaatggatggccttggagtctatcctgcacaggaagtttactcaccag
agtgatgtatggagctacggggtaactgtctgggagctgatgacgtttggctctaagccc
tacgacacgattccagcaagagatatcccagaggttttagaggggggcgagcggcttccc
caaccccttatctgcaccattgatgtctacatgatcatggtcaaatgttggatgattgat
cctgagagcaggccgagattcaaaggcctggtcaatgattttagtgccatggctagagat
cctactcgctatgtagttattcagaatgatgaagagatgagcaagtgcagcccagtggac
agtgagttttacaggatgcttctgagggaagatgaaaatattggggaaatgatcctggat
cctgaggagtacctggtgccaaatacaaggaaaggggacgagccccaggccaatggacta
tccagacaccagtcatacaggcagagcagagatcatagcttagatatggacccttccaac
actgctgggcctcggaaccttcactcctccctgactggaatcagccacgcccagtaccca
accttaacaatgggagcgagcgcctctaacagtgtgtggcctcagtatccaatgctggct
cgcagcacctcagctggaggtcagtctgactctgtcttcctggatgcacctacagacagc
cactccttggcaccagccagccccggacgctacagcaaagaccccactttccccaacggg
agcaaggatgacctagaaactgatgggtggaatggttttccccatccttatcttcaccac
tcactaccccggcggagtcacgccattcaaaatcatcccctgccagagtacgtcaaccaa
gaaattcaggatctcaggccagggttccctgagcggcccagcacactgcctcgaaaatcc
agaatagaccgccggcttcctaacggcttaagttcaggtcacagtgtggaaaacccaggg
tatttgatcccagtgaactccacctctccggcctttgacaacccatactatctggacctc
gggcccaaggtgattcccggggctgtggcgggggacggcccagcaggactggaaagcaac
ggaggagtaaccagacatatgaacggttttgtgacaccgactgcagaaaatccagaatac
ttaggattagcagacacttggagtgggcatacttga

DBGET integrated database retrieval system