KEGG   Maylandia zebra (zebra mbuna): 101482875
Entry
101482875         CDS       T02814                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2 isoform X1
  KO
K04291  lysophosphatidic acid receptor 2
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04080  Neuroactive ligand-receptor interaction
mze04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101482875
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101482875
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mze04030]
    101482875
G protein-coupled receptors [BR:mze04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    101482875
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF1634
Other DBs
NCBI-GeneID: 101482875
NCBI-ProteinID: XP_004569131
UniProt: A0A3P9C9T2
LinkDB
Position
LG6
AA seq 366 aa
MGNITGTCHDNETIDFFYNNSGKAINTQWKKRDVLIVTLGLIVCFIVIFSNFLVVAAIFK
NRRFHFPIYYLLGNMALADLFAGFAYLHMMFHTGPWTIKLSPNQWFTRQGLINTSLTASV
LNLLFVAVERHQTIFNVQLHSSMSTRRVFIVMVLIWLVAIIMGLVPQMGWNCTCHLSECS
TMAPLYHRSFLIFWAVLNLMTFSIMVAVYTRIFLYVRHKGRQMSQHTSTTRQRETMMNLM
KTVSMILGCFVVCWTPALVVLLLDGLNCDRSLVLGPEKYCLVLAECNSFVNPIIYCFRDQ
DMRRTFKEILCCNWSQRHKNRGFSEVKFHTVEQENGKSRIPKAKERSNGAPLIRASSEDI
PASLIN
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgggtaacataaccggtacctgccatgacaatgagaccatcgactttttctacaacaac
agtggaaaagccattaatactcaatggaaaaagcgtgacgttcttattgtcacgctgggc
ttgattgtttgcttcattgttattttttccaactttttggtagtagcggccattttcaaa
aacagacggtttcactttcccatctactacttgttgggtaatatggctttggcagacctt
tttgcaggttttgcgtatctccacatgatgtttcatactggtccctggactataaagcta
tcaccgaaccagtggtttactcgtcaggggttgataaatactagcctgacagcctcggtc
ctcaacctcctattcgtggctgtggagcgccaccagactatcttcaacgtccagctacac
agcagcatgagcactcggcgtgttttcatagtcatggtgttaatttggctggtggcaata
atcatgggcctcgttccccaaatgggttggaactgcacgtgccatctaagtgaatgctcc
accatggcaccgctataccaccgcagcttcctgatattctgggccgttcttaacttgatg
accttctccatcatggtggccgtatatacccggatctttctttatgtgaggcacaagggc
aggcagatgtcacagcacacttcgacgacaagacagagagaaaccatgatgaacctgatg
aagacagtctccatgatcctgggctgctttgtggtctgctggacacccgcactggttgtg
ctgctgctcgatggtctgaactgtgacaggagtttggtgctaggccccgagaaatactgt
ctggtgctggcagagtgcaactccttcgtcaaccccatcatctactgcttcagggaccaa
gacatgaggaggaccttcaaggagatcctgtgctgcaactggtctcagaggcacaagaac
agaggcttctctgaagttaaatttcacaccgtggagcaagagaatggtaagtctcgtatc
cccaaggcgaaagagaggagcaacggggcgcctctcatccgtgccagctcagaggacatc
cctgcaagtctgattaactga

DBGET integrated database retrieval system