KEGG   Maylandia zebra (zebra mbuna): 101483031Help
Entry
101483031         CDS       T02814                                 

Gene name
hdac4
Definition
(RefSeq) histone deacetylase 4 isoform X1
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101483031 (hdac4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mze03036]
    101483031 (hdac4)
Enzymes [BR:mze01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101483031 (hdac4)
Chromosome and associated proteins [BR:mze03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101483031 (hdac4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 101483031
NCBI-ProteinID: XP_004559274
LinkDB All DBs
Position
LG16
AA seq 1124 aa AA seqDB search
MPSLLSFHIKSARATAAITMSSHSCQGGLTSTEKPLELIKPTAHNHFVDVSTAALPSTAT
AILPMDLRIVDHAHHHQQQPSFGLVPPPHPTPPTSTSTETGRGPVISQQEQHLQQELVAL
KHKQQLQRQLLIAEFQRQHEQLSRQHEAQMQEHVKHQQELLALKHQQELLEHHRKMEQQR
HEEQLEKQQREHKLQQLKNKERGQESAVASTEVKMRLQEFVLNKKKALAQRNLNHCLPSD
PRYWYGKTQHSSLDQSSPPQTALSAYNHPMLGTYDSKDDFPLRKTASEPNLKLRSRLKQK
VTERRSSPLLRRKDGPLATVKKRPLDVAESACNSAPGSGPSSPNNGSSNIPTENGITICS
SPGETSLLQRLATREGSVSHLSLYTSPSLPNITLGLPATGPASTVVSGHQDGESHLALPA
LQQGIPLTPPFLPSHLPSYLASSALDREGPGGGTVGHNPLLQHMVLLDPSHSPVVGLGGL
PLPSSSVSKLMRSHRPLGRTQSAPLPQQQCGQTQALQHLVVQQQHQQFLEKHKQLFQQQQ
QQHIINKIMSKPGDQASAAGPGASGPGRQHQSHPEETEEELREHQALSSSSSSSSPTSGQ
ETGLLRGVVIKQEPPDPQEQEEREQRERQAEQDFLFRQQALLLEQQRIHQLRNYQASMEA
AGLSANFAGHRPLSRAQSSPASSSFPMVVQEPPAKPRFTTGLVYESLMQKHQCICGSTTS
HPEHAGRIQSIWSRLQETGLRAHCECIRGRKASLEELQTVHSEAHVMLYGTNPLRQKLDS
SVNPMFVRLPCGGIGVDSDTIWNEVHSSSAARLAVGSVVELVFKVASGELKNGFAIVRPP
GHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSKILIVDWDVHHGNGTQQAFYADPSVLYL
SLHRYDDGNFFPGSGAPDEVGSGAGEGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIAN
EFAPDMVLVSSGFDAVDGHAPPLGGYKLTAKCFGYLTRQLMGLAGGRLVLALEGGHDLTA
ICDASEACISALLGNELDPIPDEVLQQRPNANAVRSMEKVIEFHSKYWCSLQRSASSLGY
SLSEALKREAEEAETVSAMASLSVANKHVGKRAEEEPMEEEAPM
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgctcctctctttccacatcaagtctgcacgagcaacagcagccataacaatg
agctctcacagttgccaaggtggattaaccagcacggagaagcctctggaacttattaaa
ccaacggcacacaaccattttgtggacgtgagcacagcggcgctgccctccaccgccaca
gccatccttcccatggatctgcgcatagtggaccacgctcaccaccaccagcagcagccc
tcctttggcttggttcctccaccccaccccacgccacccacctccacgtctactgagaca
ggccgcggaccagtcattagccagcaggagcagcacctgcagcaggagctggtggctctt
aaacacaagcagcagctccagaggcagctactcatcgcagagtttcagaggcaacatgaa
cagctatcacgacaacatgaagcccagatgcaggagcatgtcaagcaccaacaggagtta
ctggcgctcaagcatcaacaagaactgttggagcaccacagaaagatggagcaacaacgt
cacgaggagcagctggagaagcagcagcgggaacacaaactccaacagctcaaaaacaag
gagaggggacaagagagtgcagtcgccagtacagaggtaaagatgcgacttcaggagttt
gtcctgaacaaaaagaaagccttggctcagcgaaacctaaaccactgtctgcccagtgac
ccacgctactggtatggaaaaactcagcatagctctttggaccagagctcacctccacaa
acggcactgtcagcgtacaaccatcccatgctgggcacatacgactccaaagatgacttc
cctctccgcaaaaccgcctctgagcccaacctaaagcttcgttctcggctaaaacagaag
gtgacggagcgtcgcagcagccctctgctccgtaggaaagatggaccccttgctactgtt
aagaagcgtcccctagacgtcgctgagtctgcatgtaacagtgcaccaggctcaggtccc
agttcccccaacaatggctccagtaacatccccacagagaatgggatcacaatctgcagc
agtccaggagagacctcgctgctccagaggctggcaacacgggaagggtcagttagccac
ctctctctctacacctctccgtctctgcccaacatcaccctgggcctgccagccacagga
cctgctagcactgtggtatcgggacaccaagatggcgagagtcatctggcattgcctgca
ttgcagcagggcattccactgacccctcctttcctgccctcccacctgccctcctacttg
gcatcttcagcactggacagggagggcccaggagggggcacggtgggtcacaaccccctc
ctccaacacatggtactgctggatccaagccacagtccagtggttgggctgggtggccta
ccgctgccatcgtcctccgtctccaagctcatgcgcagccaccgtcccctggggagaacg
cagtcggcgcctctgccccagcagcagtgcggacagacacaggccctgcagcacctggtg
gtccagcagcagcaccagcagttcctggagaagcacaaacaactgttccaacagcagcag
cagcagcacatcatcaacaagataatgtccaagcccggcgatcaggcctcagctgcaggc
ccgggagcctcaggaccaggcaggcaacaccagagtcacccggaagagacggaggaggag
cttagggagcaccaggcgctctcctcgtcatcatcgtcctcctctcctacctctgggcaa
gagacggggttgctacgtggggtggtcatcaagcaggagcctccggatccccaggagcaa
gaagagagggagcaaagagagaggcaggctgagcaggacttcctgttcagacagcaggct
ctgctcttagagcagcagcggatccaccagttgaggaattaccaagcctcgatggaagca
gccgggctttcggccaattttgctggccaccggcctctgtcgagagctcagtcatcgcca
gcctcttcctccttccccatggtcgtgcaggagccgccagccaaacctcgattcactaca
ggtcttgtgtatgagtctttgatgcagaagcaccagtgcatatgtggtagcacaacgagt
catccagagcacgctggccgcattcagagcatctggtcccgactgcaggaaacaggcctc
agggcgcactgtgagtgtatccgtggtaggaaggcctcattggaggagttgcaaacagtc
cactctgaagcccacgtcatgctatatggaactaacccgctgcggcagaaactagacagt
tcagtaaatcccatgtttgtgaggttgccgtgtggaggcataggggtggacagcgacacc
atttggaatgaagtccattcatccagcgcagcgcgtctggctgttggctctgtggtggag
ctcgtcttcaaagtagcatcgggagaactgaagaatggcttcgctatcgttcgaccccct
ggacaccacgctgaggagagcacacctatgggtttctgttattttaactcagtcgccata
gcagccaagctcctgcagcagaggctcaatgtcagtaaaatcctcatcgtagactgggat
gtccaccatggcaatggaacccagcaggccttctacgctgaccccagtgtcctttacctg
tccctgcatcgttacgatgatgggaatttcttcccgggaagtggcgcacccgatgaggtg
ggcagtggagcaggtgaaggttttaacgtgaacatggcctttactgggggactggaccct
cctatgggggatgcagagtatctagctgcattcaggacggtggtcatgcctattgccaat
gagtttgcgcctgatatggttctggtatcttctggctttgatgcagtagatggacatgcc
ccaccgctgggaggatacaaactgacagccaaatgctttggctacctgaccaggcagctg
atgggtctggcaggcggtcggctggtgcttgccttggaggggggtcacgacctcacagcc
atatgtgatgcctctgaagcctgcatctctgctctgcttggcaatgagttggaccccatt
cccgatgaggtgctgcaacagagaccaaatgcaaatgcggtacggtctatggagaaagta
atcgaatttcacagtaaatactggtgctcactgcaacgttctgcctcctcgctgggttat
tctttgagtgaggccctcaagcgtgaagcagaggaagctgaaactgtttctgccatggcc
tcattgtctgttgcaaacaagcacgttggaaagagggctgaagaggaaccgatggaagag
gaagctcctatgtaa

DBGET integrated database retrieval system