KEGG   Maylandia zebra (zebra mbuna): 101483296
Entry
101483296         CDS       T02814                                 

Gene name
bad
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04140  Autophagy - animal
mze04210  Apoptosis
mze04370  VEGF signaling pathway
mze04510  Focal adhesion
mze04910  Insulin signaling pathway
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101483296 (bad)
   04370 VEGF signaling pathway
    101483296 (bad)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101483296 (bad)
  09143 Cell growth and death
   04210 Apoptosis
    101483296 (bad)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101483296 (bad)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101483296 (bad)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101483296 (bad)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact PUMA
Other DBs
NCBI-GeneID: 101483296
NCBI-ProteinID: XP_004554396
LinkDB
Position
LG3
AA seq 158 aa
MAANFKISDSDSEASEEVGEGENQQSAGQAQESKPQTLSLPVTKTTAAGRLRVNSESHTS
SIARDEELMARGEDEVCTPTEGDPFRRRSKSAPPALWAAKKYGRQLRRMSDEFDSLLDKG
EMKVKKLHHSKTWWSYLFSHQETEGENNHLENHNQRTE
NT seq 477 nt   +upstreamnt  +downstreamnt
atggctgcaaacttcaaaatttcagacagtgattcagaggcatcagaggaggtaggggaa
ggagaaaaccaacagtcagcaggacaagctcaagaaagcaagccccagacgctttccctt
cctgtaaccaaaacgacagctgctggaaggctcagggtgaactcagagtcccacacttcc
tcaattgccagggatgaggagctcatggctagaggggaggatgaggtctgtactcccaca
gagggagacccattcaggcgaaggtcaaagtcagctccccctgctctgtgggctgccaag
aagtacggcaggcagcttcgacgaatgagtgacgagtttgacagcttactagataaaggg
gagatgaaggtcaagaagctgcaccactctaaaacctggtggagctatctctttagtcac
caagagactgaaggagagaacaaccatcttgaaaaccacaaccaacgcactgagtaa

DBGET integrated database retrieval system