KEGG   Maylandia zebra (zebra mbuna): 101483503
Entry
101483503         CDS       T02814                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A
  KO
K04291  lysophosphatidic acid receptor 2
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04080  Neuroactive ligand-receptor interaction
mze04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101483503
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101483503
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mze04030]
    101483503
G protein-coupled receptors [BR:mze04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    101483503
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 101483503
NCBI-ProteinID: XP_004559637
UniProt: A0A3P9CA16
LinkDB
Position
LG4
AA seq 351 aa
MATESIVENTCYYNENVTFFYKVVNKTISTGWNTRDYVVIGLGLTVCVIVLLANLLVMIA
IFMNRRFHFPIYYLLGNMAAADLFAGIAYTNLMLHTGPWTRTLTKEQWYIRGALIDISLT
ASVANLLAVAVERHQTIITMQLHSTMPKRRVVLLIVCIWATGIIMGLVPTFWNCECDLKD
CSTLAPLYSRRFLIFWAVLNLLTFFVMVAVYTRIFIYVKNQSKNTSQQVTEIRQQTVVNL
MKTISMVLGAFVICWTPGLVTLLLDGLLGKESHANRYEKYCLFIAECNSLVNPIIYSLRD
DEMRTTFKWILCSLCRRGVHQQRQLSLVKRGTSLREETLGSGLKSEAEALC
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggccacagagagcattgtggagaatacctgttactacaacgagaatgtcaccttcttc
tacaaagtggtgaataagacgatcagtacaggatggaatacacgggactatgttgtcatt
ggactgggcttgacagtatgtgttattgtactcctggccaacttgctggtgatgatagcc
atttttatgaaccgccgctttcactttcctatctactatctcctggggaacatggctgca
gcagacctgtttgcaggtattgcttataccaacctgatgttgcacacaggcccgtggact
agaacacttaccaaggagcagtggtatatccgcggcgctttgattgacatcagcttgaca
gcctctgtggccaacctccttgctgttgctgtggagcgacaccagaccatcatcaccatg
cagcttcacagcactatgccaaagcggcgtgtggtgctgctgatagtatgcatctgggcc
acaggtatcatcatgggcctggtgccgacattttggaactgcgagtgtgatcttaaggac
tgctccacccttgcgccgctctacagccgccgcttccttatcttctgggcagtcctcaac
ctgctcacgttcttcgttatggtggccgtgtatactcgaatctttatctacgtgaagaac
caaagtaagaacacgtctcaacaagtcacagagatccgacagcagactgttgtcaacctg
atgaagacgatatccatggtcctgggtgcctttgtaatttgctggacgcctggcctcgtg
actctcttactggatggactgttgggtaaagagagtcatgccaaccgctatgagaaatac
tgtttgttcatagctgagtgcaactctctggtcaatcctatcatctattccctacgggac
gacgagatgcggacgacgttcaagtggatcctgtgctctctgtgtcggagaggtgttcat
cagcagaggcaactttcacttgtcaagaggggcacatctctgcgagaggaaacacttggc
tctggcctgaagtcagaagccgaggccttgtgttag

DBGET integrated database retrieval system