KEGG   Maylandia zebra (zebra mbuna): 101484184Help
Entry
101484184         CDS       T02814                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00010  Glycolysis / Gluconeogenesis
mze00030  Pentose phosphate pathway
mze00051  Fructose and mannose metabolism
mze00052  Galactose metabolism
mze01100  Metabolic pathways
mze01200  Carbon metabolism
mze01230  Biosynthesis of amino acids
mze03018  RNA degradation
Module
mze_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101484184
   00030 Pentose phosphate pathway
    101484184
   00051 Fructose and mannose metabolism
    101484184
   00052 Galactose metabolism
    101484184
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101484184
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mze01009]
    101484184
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mze03019]
    101484184
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101484184
Protein phosphatases and associated proteins [BR:mze01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101484184
Messenger RNA biogenesis [BR:mze03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101484184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 101484184
NCBI-ProteinID: XP_004565577
LinkDB All DBs
Position
LG18
AA seq 856 aa AA seqDB search
MAGASAPKRQDTRKFFENLSGAGKSIAVLTSGGDAQGMNAAVRAAVRMGIYVGAKVYFIH
EGYQGMVDGGDNIKEAKWESVSSMLQVGGTVIGSARCKDFRTHEGRLKAAHNLVQRDITN
LCVIGGDGSLTGANLFREEWSSLLEELLQQGLIDEEATQRNSELHIVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPE
MPPEDGWEDNMCQKLSENRADKKRLNIIIVAEGAIDRHNKSITPDYIKDLVVRRLGFDTR
VTILGHVQRGGTPSAFDRILASRMGVEAVLALLEASANTPACVVSLVGNQAVRLPLMECV
QMTQEVQKAMDEKKFDEAVRLRGRSFENNLSTYRLLSFRKADSELPNGEEEAGDEEQIDS
SFNVAVMNVGAPAAGMNAAVRSAVRVGITEGHKMFAVNDGFEGFYKGQIKEIKWGDVGGW
TGQGGSLLGTKRTLPGKHLDKIAEQMRIHNINALLVVGGFEAYVGLLELAAARDKYEEFC
VPMVMVPATVSNNIPGSDLSIGSDTALNAITDAFESILQLYVARADYEEFCIPMCILPAT
ISNNVPGTDLSLGADTSLNAIVETCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAA
GADTVYIYEEPFDIRDLQANVEHLTEKMKTSIQRGLVLRNENCNENFTTDFIYQLYSEEG
RGVFDCRKNILGHMQQGGAPSPFDRNFGTKIAAKAMQWITRTLKESYKGGRVFANSEDTA
CLLGMRRRSLVFQPVAQLRDETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLE
HVTRVRPKDSNTSTAI
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggctggcgcatcggcaccaaagcgacaggacacccggaaattctttgagaatctatcc
ggcgctggtaaatccatcgcagtgttgaccagcggcggagatgcccaaggtatgaatgca
gctgtccgggctgccgtgcggatgggcatctatgtgggagcaaaggtctacttcatccat
gagggttaccaggggatggtggacggtggagacaacatcaaagaggcgaagtgggaaagc
gtctccagcatgctgcaagtgggtggaactgtcatcgggagtgcccgctgcaaagatttc
cgtacccatgagggccgcctgaaagctgcacacaaccttgtgcagcgtgacatcaccaac
ctgtgtgtgattggtggagacggaagcttgactggggccaacctgttcagggaggaatgg
agcagcctgttggaggagctcctgcagcaaggtttgatcgatgaggaagcgacccagaga
aactccgagctccacatcgtcggtatggttggctccatcgacaatgacttctgcggcact
gacatgaccattggcaccgactcggccctgcatcggatcattgaggtggtggacgccatc
atgaccactgcccagagccaccagaggacgtttgtcctggaggtcatggggagacactgc
ggatatctggccctggtcagcgccctggcatgtggagcagactgggtttttatcccagaa
atgcctcctgaagatggatgggaagacaacatgtgtcagaaactgtccgagaatcgtgct
gataagaaaaggctgaacattattattgtagccgagggtgccatagatcgccacaacaaa
tcaataacccccgattatatcaaggatctggtagtgcgccgcctgggttttgacaccagg
gttactatcttgggccatgtgcagagaggtggaacaccctcagcgtttgacagaatcctg
gcaagccgcatgggtgtggaggcagtgctagcattactggaggcatctgcaaacaccccg
gcctgcgtcgtgtctctggttggcaaccaggctgttcgactgccacttatggagtgtgtt
cagatgactcaagaagtacagaaggccatggatgagaagaaatttgatgaggcggtcaga
ctgcgtggcaggagcttcgaaaacaatctgagcacttaccgactcctctcatttcggaag
gcagattctgaacttccaaatggagaggaggaggcgggggatgaagagcagattgatagc
tcctttaatgtggcagtaatgaacgtcggtgctccagcagcaggtatgaatgctgctgtt
cgttctgctgtcagagtgggaatcaccgaaggccacaaaatgtttgctgtaaacgatggc
ttcgagggattctacaaaggacagattaaggagatcaaatggggagatgttggtggttgg
actggccagggtgggtcactgctagggacaaaaagaactcttccaggaaaacatctggat
aagatcgctgagcagatgaggattcataacatcaatgctctgcttgtggtcggagggttt
gaggcctacgtgggattactggaactcgctgctgcacgggacaaatatgaggagttctgt
gtgcccatggttatggtcccggccaccgtctccaataatatacccggttcagacctcagc
attggttcagacactgctctgaatgccattactgacgcctttgagtccattctgcagctg
tatgtggcccgggctgactacgaggagttttgcatcccgatgtgcatattgcctgccacc
attagtaacaatgtgcctggcactgacctcagtcttggagctgatacatccctcaacgcc
attgtggagacatgtgatcgcatcaaacagtcagctagcggcaccaagcggcgagtgttc
atcattgagacaatggggggctactgtggctacctggccaccgtgggtggtctggctgca
ggcgccgacactgtctacatctacgaggagccatttgacatccgtgaccttcaggccaac
gtggagcatctgacagagaagatgaagacgagcatccagaggggactggtgctcagaaat
gagaactgcaacgagaacttcaccacagatttcatctaccagctttactctgaggaaggg
cgaggagtgttcgactgcaggaagaacatcctcggtcacatgcagcagggaggagctcca
tctccctttgacagaaactttggtaccaaaattgcagccaaagccatgcagtggatcacc
cggacactcaaggagtcctacaaaggagggagagtgtttgcgaactcggaggacaccgca
tgcctgctggggatgcgtcgcagatctctggtctttcagcctgtggcgcagctccgggat
gagacagactttgttcacaggatccctaaggagcagtggtggctgaagctccgtcctcta
atgaaaatcctggccaagtataagacaagctatgacgtgtccgactccgggcagctggaa
cacgtgacgcgggtccgacccaaagacagcaacacctcaacggccatctga

DBGET integrated database retrieval system