KEGG   Maylandia zebra (zebra mbuna): 101485361
Entry
101485361         CDS       T02814                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04068  FoxO signaling pathway
mze04110  Cell cycle
mze04115  p53 signaling pathway
mze04218  Cellular senescence
mze04310  Wnt signaling pathway
mze04340  Hedgehog signaling pathway
mze04371  Apelin signaling pathway
mze04510  Focal adhesion
mze04530  Tight junction
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101485361 (ccnd1)
   04340 Hedgehog signaling pathway
    101485361 (ccnd1)
   04371 Apelin signaling pathway
    101485361 (ccnd1)
   04068 FoxO signaling pathway
    101485361 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101485361 (ccnd1)
   04115 p53 signaling pathway
    101485361 (ccnd1)
   04218 Cellular senescence
    101485361 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101485361 (ccnd1)
   04530 Tight junction
    101485361 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101485361
NCBI-ProteinID: XP_004575644
UniProt: A0A3P9CL13
LinkDB
Position
LG1
AA seq 292 aa
MEDQLLCCEVDSIRRAYQDVNLLNDRVLHTMLKAEENYLPSPNYFKCVQKEIVPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEATRKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVLPGELLQMELLVLNKLKWDLASVTPHDFIEHFLSKLKIYPSTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVAAAVQGLYLKSQDASLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHNGTTETKRVDEDADLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaggaccagctgctgtgctgtgaggtggactcaatcaggagagcttaccaggacgtc
aacctgctcaatgaccgagttctacacaccatgctcaaggccgaagaaaactacttgcct
tcgccaaactacttcaagtgtgttcagaaagaaattgtaccaaaaatgcgaaaaatagtt
gccacctggatgttggaggtctgcgaggaacagaaatgtgaggaggaggtttttccgctc
gctatgaactacttggacagatttctatcagttgaggccaccaggaaaacaagactacag
ctgctcggagccacatgcatgtttctagcatcaaaaatgaaggagactgtgcccttaacg
gcggagaaactctgtatttacacggacaactcggtcctgcccggggaactgctgcaaatg
gagctgctggttctcaacaagctcaagtgggatctggcttcagtaactcctcatgacttc
atcgagcacttcctgtccaagctgaagatctatccctccaccaagcagatcctcaggaaa
catgcccagacctttgtggcactgtgtgctacagatgtcaacttcattgccagccctccc
tcaatggtggccgcagggagtgtagcagcagctgttcaagggctctacctgaagagccaa
gatgcgtccttgtcttcccagaacctcactaactttctgtcgcaggtcattcgtagcgac
ccggactgcttgcggtcatgtcaggagcagatagagtctctgctggagtctagcctgcga
caggcacaacagcacaatggcacaacagaaactaaacgagttgacgaggacgcggacttg
tcctgcaccccaacagacgtcagagacatcaacatctga

DBGET integrated database retrieval system