KEGG   Maylandia zebra (zebra mbuna): 101486684
Entry
101486684         CDS       T02814                                 

Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101486684
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mze04052]
    101486684
Cytokines and growth factors [BR:mze04052]
 Cytokines
  CSF and other factors
   101486684
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 101486684
NCBI-ProteinID: XP_004572244
UniProt: A0A3P9D6N0
LinkDB
Position
Unknown
AA seq 204 aa
MGNRRTYGPNREDPVRGYADAAMEFPRLLALLLLVLDWTQPGLSSPLRPICDLRVLNHFI
QEARDAEGAMKSCREGCGLSQSVTVPQTTVDFDVWEKKNAQEQAQEVQTGLWLLQQSLNT
LQTSVTNTAMHSHIDNTIRNLLSINAVLRSLNIQEFTPPANATDLEGTWRVSLATDLLQV
HVNFLRGKVHLLLSSAQACKPDVS
NT seq 615 nt   +upstreamnt  +downstreamnt
atgggcaatagacggacctatgggccaaaccgcgaggaccctgtgaggggctatgcggat
gccgctatggagtttcccagactgcttgccttgctgttgttagtgttggactggacccag
ccaggcttgtcatccccactgaggccaatttgtgacctgagggtcctgaaccatttcata
caggaagcacgagacgcagaaggtgctatgaagtcatgtagagaaggctgtggcctgtcc
cagtctgtcaccgtcccccagactacagtagactttgatgtatgggagaagaaaaatgca
caggaacaagcccaggaggtgcagactggcttatggttgttacaacagtccctcaacacg
ctacagacgtcggtcaccaacacagcaatgcacagtcacatagacaacaccatcagaaac
ctgctcagcatcaacgctgtgttgcgtagtctcaacatccaggaatttacaccaccagca
aatgcaacagaccttgagggaacatggagggtgtccttagcaacagatctgcttcaggtc
cacgtcaacttcctgcgaggcaaagtgcaccttcttctttcaagtgcacaggcatgcaag
ccagatgtcagctga

DBGET integrated database retrieval system