KEGG   Maylandia zebra (zebra mbuna): 101486967
Entry
101486967         CDS       T02814                                 

Gene name
tgfa
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101486967 (tgfa)
   04012 ErbB signaling pathway
    101486967 (tgfa)
SSDB
Motif
Pfam: EGF Laminin_EGF V_ATPase_I
Other DBs
NCBI-GeneID: 101486967
NCBI-ProteinID: XP_012773921
UniProt: A0A3P9CGS0
LinkDB
Position
LG5
AA seq 252 aa
MMTRIFWGTILLISGSLFTFGAGHSSSVTIEANISISINSTAPPDASSSSSAATSSTSTT
IPATTNIPTVKSSLFIVGPRQTNATVTDATISINATSSAANTSASSSSTNTSSSATKSLT
GTTTINIHPVKKFVAAAVRSHFDDCPDSHRHFCFHGTCRFLILEETPACVCHPGFIGMRC
EHADLLAVVATNHRQQTIATMLVLCVIGCVLIMVLCTVLHCWWRQDCRRRSHAHHHVTEK
HGVSCCPSESVV
NT seq 759 nt   +upstreamnt  +downstreamnt
atgatgactcggattttctggggaacaattttactcattagcggctctctctttaccttc
ggagcagggcacagcagttcagtaactattgaagccaatatttccatcagtataaactcc
actgctcctccagatgcctccagtagcagctctgcggcaactagcagcacaagcacaaca
attccagccacaaccaacatccctacagttaaaagttctctctttatagtcggaccaagg
cagacaaatgcaacagttactgatgccaccatttctattaatgccacctcctctgctgct
aacacctcagcaagcagctcttcaacaaacaccagcagcagcgcaaccaaaagcctcact
ggaaccactactatcaacatccaccctgttaaaaagtttgtagcagcagcggttcggtct
catttcgacgactgtccagactcccaccgacacttctgcttccacggcacgtgccgcttc
cttatactggaagagacacccgcatgtgtatgtcatccaggctttatcgggatgaggtgt
gagcatgcagacctcctcgctgtagttgcaaccaatcacaggcaacagaccattgccacg
atgctggtgttgtgtgtgattgggtgtgttctcatcatggtgttatgtacagtcttacac
tgctggtggagacaggactgtcgcaggcgcagccacgcacatcaccatgttacagaaaag
cacggcgtgtcctgctgtccatctgagagtgtggtctga

DBGET integrated database retrieval system