KEGG   Maylandia zebra (zebra mbuna): 101487069Help
Entry
101487069         CDS       T02814                                 

Gene name
tufm
Definition
(RefSeq) elongation factor Tu, mitochondrial
  KO
K02358  elongation factor Tu
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Translation factors [BR:mze03012]
 Eukaryotic Type
  Elongation factors
   101487069 (tufm)
 Prokaryotic Type
   101487069 (tufm)
Mitochondrial biogenesis [BR:mze03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    101487069 (tufm)
Exosome [BR:mze04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101487069 (tufm)
  Exosomal proteins of breast cancer cells
   101487069 (tufm)
  Exosomal proteins of colorectal cancer cells
   101487069 (tufm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 101487069
NCBI-ProteinID: XP_004573771
LinkDB All DBs
Position
LG4
AA seq 446 aa AA seqDB search
MAALVGLRACLSALQLSSPSLLHSSFKLCAVPLSRRTFAAEAKKTYSRDKPHVNIGTIGH
VDHGKTTLTAAITKVLADAGGARYKKYEDIDNAPEEKARGITINASHVEYTTANRHYAHT
DCPGHADYVKNMITGTAQMDGCILVVAATDGQMPQTREHLLLARQIGVEHVVVFINKADA
VEDKEMLELVEIEIRELLTEFGYDGENTPVLIGSALCALENKAPELGVNAVMKLLEIVDS
YVPLPKRELEKPFLLPIEGVYSIPGRGTVVTGTLERGVIKKGDDCEFVGHNRSFKSVVTG
IEMFHKSLDRAEAGDNLGALVRGLKREDIRRGMVMCKPGCIMPHQKVRAQVYVLSKEEGG
RHKPFVTNFMPVMFSLTWDMACRVTLPADKEMVMPGEDTSLTLTLRQPMVLEKGQRFTLR
DGNRTIGTGLVTEIMTTTDEDQCNWG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcttgtggggctgcgtgcgtgtttgtccgcccttcagctttcttcaccaagc
ctcctgcacagctccttcaaattgtgtgctgtgcctctgagccggcgaaccttcgctgcg
gaggcgaagaagacatacagcagagacaagccccacgtaaacatcgggacgatcggccac
gtcgatcatggcaaaaccaccctgacggcagccatcacaaaagtgctcgctgatgctggt
ggtgcccgctacaagaagtatgaggacattgacaatgcccctgaggagaaagccagagga
attaccatcaacgcctcgcatgtagaatacaccacagccaacagacattatgctcacaca
gactgccctggacacgctgactatgtcaagaacatgatcacaggcacagctcagatggac
ggctgcattctggtggtggcagccactgacggccagatgcctcagacacgtgagcacctg
ctgttggcccggcagatcggtgtagagcacgtggttgttttcataaacaaggcagacgcc
gtggaggacaaggagatgctggagctggtggagatcgagatccgcgagctgctcacggag
tttggctacgacggcgagaacacacccgttttgattggctctgcactctgtgctctggag
aacaaagctcctgagctgggggtgaatgcagtgatgaaactgctggagattgtggactct
tacgttcctctgcccaaaagagagctggaaaaacctttccttctgcccattgaaggggtt
tattcaatcccaggcaggggtacggttgtgacgggcactctggagaggggcgtcatcaag
aaaggagacgactgtgagtttgtgggtcacaaccgcagcttcaagtctgtagtgacaggt
attgagatgttccacaagtctctggaccgggcagaggcaggagataacctgggcgctctg
gtccgaggcctgaagagggaggacataaggagagggatggtgatgtgcaagccagggtgc
atcatgcctcaccagaaagtcagagctcaggtctatgtactgagtaaggaggagggaggc
agacacaagccgtttgtcaccaacttcatgcccgtcatgttttctctcacctgggacatg
gcctgcagggtcactttacctgctgacaaggaaatggtgatgccaggtgaggacacctca
ttgacgctcactctccgccagccgatggttctggagaaaggccagaggttcactcttaga
gacggaaacaggaccatcggcaccgggctggtcacagagattatgacaactacagatgaa
gaccagtgcaactggggctga

DBGET integrated database retrieval system