KEGG   Maylandia zebra (zebra mbuna): 101487082
Entry
101487082         CDS       T02814                                 

Gene name
egf
Definition
(RefSeq) pro-epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04012  ErbB signaling pathway
mze04020  Calcium signaling pathway
mze04068  FoxO signaling pathway
mze04510  Focal adhesion
mze04540  Gap junction
mze04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101487082 (egf)
   04012 ErbB signaling pathway
    101487082 (egf)
   04068 FoxO signaling pathway
    101487082 (egf)
   04020 Calcium signaling pathway
    101487082 (egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101487082 (egf)
   04540 Gap junction
    101487082 (egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101487082 (egf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mze04052]
    101487082 (egf)
Cytokines and growth factors [BR:mze04052]
 Growth factors
  Growth factors (RTK binding)
   101487082 (egf)
SSDB
Motif
Pfam: Ldl_recept_b cEGF FXa_inhibition EGF_CA DUF5050 EGF EGF_3 EGF_MSP1_1 DUF4494
Other DBs
NCBI-GeneID: 101487082
NCBI-ProteinID: XP_004553672
LinkDB
Position
LG2
AA seq 1159 aa
MPEAMITVILIYFMMQTAGALLLGTTCWDEHLLQAGSNSSCTASQPFLIFGHGKAIHRMG
LNGKNHRRLVPGVGSSILLDFHFKEQRVYWVDRHTGVIYKASVKGAHKQKLYSYDKHISG
LAVDWIWNSVYWTSGEKGEVKRIDINGKKQRTLLRHLTQPNSISVDPSNRFLFWLSGGMS
PSIQRSDVTGQMKITLIKITEQLRALSIDRVDKRLFWVQFGPQGESAIASCDYNGNALHT
MNLPLQSHSVGISVFLEHIYYTDSESRVIKQVNKYTGGEPHVVNIKQMGKPPVDIKIVHP
LNQPTADPLSPFPGCDDQGGNCVNVCSSLADQGVCQCSEGFVLSMEGTYCKDVNECAHWN
HGCSLGCENIPGSYFCTCPKGYALLPDRKTCQEIIPCERNMTKCGNGCLSTGNGAVCVCP
EGSILQEDGQTCTGCSSADRGGCSQLCNPVTPVSWECSCLPGYQLHQDGKHCIATGPPSY
LLVANLVDVRRINPDGTVDQILAEEPRGIIVALDYDPVQNNVYFASTSQKTIERVDIKGG
PRNILISDGLDSPEGLAVDWVHRKMYWTDKRRSTVDCSTLDGLHRETIVRKGLEKPRGIA
VHPLAKKLFWTDIGTHPVVECSSLEGRDRAVIARTNLVSPTGLTIDFTEDRVFWCDQRKG
TIETAALDGSDRRVLSKNQVGQPFDLALFEDRLWISDQERHQLTSVHKRTGKTLQWIQGS
MVQPASIVVVHPLAKPGADMCLHLKGGCSQVCESKMGFAHCSCFSHYILSADGKTCLTVD
ASNGTAEYGNSGSVDLTPLKNKTFNTASLPLTTDVSSQPTFFTDKMISDQNECYSLRCDV
NAQCLLNSGHPNCLCQEGFTGDGQLCVDIDECNLGIYNCDKNEECQNTAGKYYCKCLAGY
YSDGQTCQELESTSPWVTPGTSADVTTKRHNGNAESCPATYETYCLYHGVCFYFPELDSY
ACNCVSGYMGERCQFSDLEWLELQRAEKEKKRNVVITACMVVLVSLLSITACVTYCYGTR
KRFHKQPSVDNVSETSMTDESMSETTTTTVPRFYIVAENGVEGKVIPAMGCPRRAVCTSC
SSETGANSESDESGKLSQHNKGYECSMVSAAATGTMQPTVHLSSPSLSSCTSFKPTTLPQ
TSGPESWLNGNSVQSAVQQ
NT seq 3480 nt   +upstreamnt  +downstreamnt
atgcccgaggcaatgataacagtaatattgatctattttatgatgcaaaccgctggagcc
ttgctgctcggtacgacatgctgggatgagcacctattgcaagcagggagcaacagcagc
tgtacggcttcacagcctttcctgatatttggccatggtaaagctattcatcggatgggc
cttaatggcaagaatcacagaaggcttgtgcctggcgtcggaagctctatcctgcttgac
tttcatttcaaagaacagagagtttactgggttgacaggcacactggggtcatctacaaa
gcatctgtgaaaggagcacacaaacagaaactgtattcatatgacaaacacatctctggc
ctcgcagtggactggatttggaacagcgtatactggacaagtggagaaaagggggaagta
aagagaatcgatataaatgggaagaaacagaggactcttttaagacacttgacccagccc
aattctataagcgttgacccctctaataggtttctgttttggttatctggggggatgtct
ccaagtatccaaaggtctgatgtcacaggacagatgaaaattacactaattaagataact
gaacaactgagagcactgtcgattgaccgagtagacaaaagactgttctgggttcagttt
gggccacaaggagaaagtgccattgcctcttgtgattacaatgggaacgccctacacacc
atgaatcttccacttcagtctcattcagttggaatatctgtttttctggagcacatatac
tacaccgattctgagtctcgggttataaaacaagtaaacaagtacactggtggagagcca
catgttgttaacataaaacaaatgggtaaacctccagttgatatcaagatcgtgcatcca
cttaatcagccaacagcagacccgctatcaccatttccaggttgtgatgaccaaggtggc
aactgtgttaacgtctgttccagtttggcagaccaaggcgtttgtcagtgcagtgaaggt
tttgttctcagtatggaaggcacttactgtaaagatgtaaatgaatgtgcccactggaat
catggctgctcgcttggttgtgagaacattcctggatcttatttctgtacctgtcctaaa
ggatatgccctcttaccagacaggaaaacatgccaagaaatcataccatgtgaaaggaat
atgacaaagtgcggcaatgggtgcctgtcaacaggaaatggtgctgtctgtgtttgccct
gagggatctatactacaggaggatggacaaacatgtactggctgttcatctgcagataga
ggaggatgcagtcagctctgcaaccctgtcacccctgtaagctgggagtgtagctgtctg
cctggctaccagctccaccaagatggcaagcactgcattgcaactggacctccatcttat
ctactagttgctaatctagtagatgtccggagaattaaccctgatggcactgtggatcaa
atcttggcagaggagcccagaggaataatcgtagctttagactatgaccctgtccagaac
aatgtgtactttgcaagtacaagccagaaaacaattgagcgagttgacataaaaggtggc
ccaagaaacattctcatctctgatggtttggattcaccagaggggcttgcagttgactgg
gttcatcgcaagatgtactggacggataaaaggcggtcaactgttgattgcagtactttg
gatggacttcacagggaaactattgtgagaaaaggtctggaaaagccaagaggaatcgca
gttcatcctcttgcaaagaagttattctggactgacatagggacccatcctgtggtggaa
tgttcctccctggaagggagagaccgtgctgtcattgctaggaccaaccttgtgtcgccc
actggcctgacaattgacttcacagaggaccgagtgttctggtgtgatcagaggaaaggc
acaatagagactgccgccctggatggttcagatcgacgagtcctgtcaaagaaccaagta
ggccaaccttttgatcttgcactatttgaagacaggctctggatctctgatcaggaacgc
caccagctgaccagtgtgcataagcggactgggaaaacattgcaatggatccaagggagc
atggtgcaaccagcatctattgttgtagttcatccccttgctaagccaggggcagatatg
tgccttcacctgaagggaggttgttcccaggtgtgtgaaagcaagatgggttttgcccac
tgctcttgtttctcacactatatcctatcagctgatggaaaaacttgcttgactgttgac
gcttcaaatggaacagcagaatatggaaacagtggatcagttgatttaacacctctgaaa
aacaaaacatttaatactgcgagcttgccactgacaactgatgtaagcagccagccaact
ttcttcaccgacaaaatgatttcagaccagaatgagtgctactcactccgctgcgatgtg
aatgcacaatgcctgctgaattctggtcacccaaactgtttatgtcaagaaggtttcaca
ggtgatggacagttatgtgtggatattgatgagtgtaacctgggaatctacaactgtgac
aaaaatgaagaatgtcaaaacactgcagggaaatactactgcaagtgcctggctggatac
tacagcgatgggcagacatgtcaagagttggagtccacatcaccatgggtgacacctggt
acctctgctgatgttaccaccaaacgccacaacggaaatgcagagagttgtcctgcaacc
tatgagacctactgtctgtaccatggtgtttgcttctactttcctgaattggactcttat
gcctgcaattgtgtatcaggctacatgggggaacgatgtcagttcagtgacctggaatgg
ttggagcttcagcgggctgaaaaggagaagaagaggaacgtggtcattacagcgtgcatg
gtggtcctcgtttccttgctctctatcacagcctgtgtcacctactgctatggaacgaga
aaacgtttccacaaacagccatcagtggataatgtgagtgagaccagcatgacggatgag
agcatgtcagagacaaccactaccactgttcctcggttctacattgtggcagaaaatggt
gttgaagggaaggtaattcctgccatgggctgtccaaggagagctgtgtgtacatcctgc
tcttcagaaacaggtgccaattctgaaagtgatgagtcaggaaaactgtcccagcacaac
aaaggttacgagtgttccatggtgtctgctgctgccactggaacaatgcaacccactgtg
cacctctcaagtccatcactgtcaagctgtacatcttttaaaccaacaacgttaccccag
acttcgggcccagagtcatggctcaatggaaacagcgtacaatcagctgttcagcaatga

DBGET integrated database retrieval system