KEGG   Maylandia zebra (zebra mbuna): 101487645Help
Entry
101487645         CDS       T02814                                 

Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00480  Glutathione metabolism
mze00980  Metabolism of xenobiotics by cytochrome P450
mze00982  Drug metabolism - cytochrome P450
mze00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101487645
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101487645
   00982 Drug metabolism - cytochrome P450
    101487645
   00983 Drug metabolism - other enzymes
    101487645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mze02000]
    101487645
Enzymes [BR:mze01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101487645
Transporters [BR:mze02000]
 Other Transporters
  Pores ion channels [TC:1]
   101487645
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 101487645
NCBI-ProteinID: XP_004551616
LinkDB All DBs
Position
LG13
AA seq 239 aa AA seqDB search
MSAEKCLAKGSAAPGPVPEDYIRVYSMRFCPFAQRTRLVLKAKGIKYETINVHLKEKPDW
YLKKNPLGLVPTLETPAGEVIYESPITCEYLDEVYPEKKLLPSSPFAKAQQKMMLEHFSK
VIPYFYKIPMDKKKGEDVSGLEAELKEKFAKLNEDLVNKKTKFFGGDSITMIDYMIWPWF
ERVEAYQVKQFLDGTPELKKWTELMLQDSAVKALIFSPDAHKAFFKTFLDGNPDFDYGL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgaaaagtgtctcgctaaaggtagcgctgcccctggcccagtccctgaagac
tacatcagggtttacagcatgaggttttgcccttttgcccaaaggaccagactggtgctc
aaagccaaaggaatcaaatacgaaaccataaatgtccacctgaaagaaaaacccgattgg
tatcttaagaagaatcctcttggtcttgtcccaacgcttgagacacctgctggtgaggtg
atatacgagtcacccatcacctgtgaatacctggatgaagtttaccctgaaaagaagctg
cttccctcctctccctttgctaaggctcaacaaaagatgatgctggagcacttttccaaa
gtgataccgtacttctacaagatcccaatggataaaaagaagggagaggatgtctccgga
ctggaagctgaactgaaagaaaagtttgcaaagttaaacgaggacctcgttaacaagaag
accaagttctttggtggcgattctataacaatgatcgactacatgatatggccgtggttt
gagagggtagaagcgtatcaggtaaaacagtttttggatggcacacctgagctgaagaag
tggacagaactcatgttgcaggactcggctgtcaaagccctcatattcagcccagacgcc
cacaaggccttcttcaagaccttccttgatggaaacccagactttgactatggcctgtag

DBGET integrated database retrieval system