KEGG   Maylandia zebra (zebra mbuna): 101487693Help
Entry
101487693         CDS       T02814                                 

Gene name
abat
Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00250  Alanine, aspartate and glutamate metabolism
mze00280  Valine, leucine and isoleucine degradation
mze00410  beta-Alanine metabolism
mze00640  Propanoate metabolism
mze00650  Butanoate metabolism
mze01100  Metabolic pathways
Module
mze_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    101487693 (abat)
   00650 Butanoate metabolism
    101487693 (abat)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101487693 (abat)
   00280 Valine, leucine and isoleucine degradation
    101487693 (abat)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101487693 (abat)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mze01007]
    101487693 (abat)
Enzymes [BR:mze01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     101487693 (abat)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     101487693 (abat)
Amino acid related enzymes [BR:mze01007]
 Aminotransferase (transaminase)
  Class III
   101487693 (abat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 101487693
NCBI-ProteinID: XP_014264899
LinkDB All DBs
Position
LG4
AA seq 500 aa AA seqDB search
MATSLISRQLAFSLQKNVWLSASGYRYVSKAAAKTQVEFDYDGPSMTTTVPGPRSQELMK
QLGQIQNTGAINFFCNYEESKGNYLVDVDGNRMLDIYTQISSIPIGYNHPALLKVMTNPN
NLSTFVNRPALGILPPENFPDKITESLLSVAPSGMTRVQTMSCGACSNENAYKAIFIWYR
NKERGPNTPTNEELNTSMINQAPGCPELSILSFMGGFHGRTLGCLATTHSKAIHKLDIPS
FDWPVAPFPRLQYPLDEFTRENAEEEARCLEEVEDLIVKWRQKGKPVAGIVIEPIQAEGG
DNHASPDFFRRLRNIARKHGCAFHVDEVQTGGGGTGKFWAHEHWGMDDPADVVSFSKKLL
SGGYYHKDELQADKPYRIFNTWMGDPSKNLFLSEVLNVIRRENLLEEVTRSGKALLNGLY
ELQAQYPSILSRARGQGTFCAIDACDDATRDRIMLKARDKGVLLGGCGDRTIRFRPALVF
KEYHVNLFLNIFNDVLAQHK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcaacctccttgatcagtcgtcagctggctttctctctgcagaaaaacgtgtggctc
agtgcttcaggttacagatatgtcagcaaagcagcagcaaagacacaggtggagtttgac
tacgatggaccctccatgacaactacagtccctggtccacgatcacaagagctgatgaaa
caactgggacaaatacagaatactggtgccatcaactttttctgtaactatgaggagagc
aaagggaactacctagtggatgtggatgggaaccgcatgctggatatctacactcagatt
tcttccatcccaattggctacaaccaccctgctctcctcaaagtgatgaccaatccaaac
aatttgagtacatttgtgaatcggccagccttgggaatcctgccacctgagaactttcca
gacaaaatcaccgaaagtcttctctcagtggcacctagtggaatgactcgtgttcagaca
atgtcctgtggtgcttgctccaatgaaaatgcttacaaagctatttttatctggtatagg
aacaaagaacgaggcccaaacacaccaactaatgaagaactgaacacctccatgatcaac
caggcaccaggttgtccagaactcagtattttatctttcatggggggtttccatggaaga
acattaggttgtttggcaacaacacactccaaagcgatccacaaactggacattccatca
tttgattggcctgttgccccattccccagactacagtacccactggatgagtttaccaga
gagaacgctgaggaagaggctcgttgtttggaggaggtggaagatttgattgtgaagtgg
agacagaagggaaaacctgtagcgggaattgtaattgaaccgattcaggccgaaggcggc
gataaccacgcctcaccagacttcttccgaagactgcgcaatattgcacgcaagcatggc
tgtgcttttcatgtggatgaggtccagactggtggcggaggcacaggaaagttttgggcc
catgagcactggggtatggacgaccctgctgacgttgtctctttcagcaagaagcttctg
agtgggggttactaccacaaggatgaattacaggcagacaagccctaccgcatctttaac
acatggatgggtgacccgtcaaagaacttgttcctttctgaggttctcaatgtgattcgg
agagaaaatcttttggaggaagtgacccgctctggcaaagctttgctgaatggcctctat
gagctacaggctcagtaccccagcatactgagtcgagcccgaggacaggggacgttctgt
gccattgatgcctgtgatgatgccacacgtgacaggatcatgctcaaggccagagacaaa
ggcgtcctcctcgggggctgtggggatcgcacaatcagattccgcccagctctggttttc
aaggagtatcatgtgaacctcttcctcaatatttttaatgatgtgttggcgcagcacaaa
tag

DBGET integrated database retrieval system