KEGG   Maylandia zebra (zebra mbuna): 101487930
Entry
101487930         CDS       T02814                                 

Gene name
gsk3b
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X2
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04012  ErbB signaling pathway
mze04110  Cell cycle
mze04150  mTOR signaling pathway
mze04310  Wnt signaling pathway
mze04340  Hedgehog signaling pathway
mze04510  Focal adhesion
mze04910  Insulin signaling pathway
mze04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101487930 (gsk3b)
   04310 Wnt signaling pathway
    101487930 (gsk3b)
   04340 Hedgehog signaling pathway
    101487930 (gsk3b)
   04150 mTOR signaling pathway
    101487930 (gsk3b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101487930 (gsk3b)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101487930 (gsk3b)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101487930 (gsk3b)
   04916 Melanogenesis
    101487930 (gsk3b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mze01001]
    101487930 (gsk3b)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mze03036]
    101487930 (gsk3b)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     101487930 (gsk3b)
Protein kinases [BR:mze01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   101487930 (gsk3b)
Chromosome and associated proteins [BR:mze03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101487930 (gsk3b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1 Choline_kinase
Other DBs
NCBI-GeneID: 101487930
NCBI-ProteinID: XP_004551436
UniProt: A0A3P9AVT9
LinkDB
Position
LG16
AA seq 421 aa
MSGRPRTTSFAESCKPVPQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
DKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPMVYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPETAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPSIKLPNGREKPSLF
NFTTQELSSNPSLASILIPAHARSQAAASTPTNASATTDGSSTERGPTTTTASASASNST
S
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgtcgggtcggcccaggaccacatctttcgccgagagctgcaagccagtgccgcagcct
tcagctttcggcagcatgaaagtcagcagggacaaagatggcagcaaggtaacgacagtt
gtggccaccccaggccaaggccccgaccggccacaggaagtcagctacacggacaccaag
gtcatcggcaatggctcttttggcgtcgtctaccaagctaaactctgcgactctggagag
ctggtggccatcaagaaggtcctgcaagacaagaggtttaagaatcgtgagctgcagatc
atgaggaaactggaccactgcaacatagtccgcctgcgctacttcttctattccagtgga
gacaagaaagatgaagtgtatctgaatttggttctggattacgtgcctgagaccgtctac
agagtggccagacactacagccgagccaaacagactctgcctatggtttatgtgaagttg
tatatgtaccagctcttcaggagcctggcctacattcactcgtttggtatctgccatcgg
gacatcaaaccccagaatctgctgctggatccagagacggctgttctcaagctctgtgac
tttggcagcgctaagcagctggtccgtggagagcctaacgtgtcctacatctgctctcgc
tactatcgagcccctgagctgatctttggtgccactgactacacttccagcatagatgtg
tggtcagccggctgtgtactggcagagctgctcctgggacagccgatcttccctggtgac
agcggagtggaccagttggtggaaatcatcaaggttctcggcaccccgacccgagagcag
atccgtgagatgaaccccaactacactgaattcaaattcccccagatcaaggcacatcca
tggactaaggtgttccgaccacgtacgcctccggaggccatcgccttgtgctcccgcctg
ctggagtacacgcccacggcccgcctaacacccctagaggcatgcgcacactcattcttt
gacgagctgcgcgaccccagcatcaaactgcccaacgggcgagagaagccctcgctcttc
aacttcactacccaggaactatctagtaatccttctttggcctccatactcatccctgcc
cacgcccgcagccaggctgccgcctctaccccaaccaatgcatctgccaccacagatggc
agcagcacagagcgaggtcccaccaccaccaccgcctctgcctcagcttccaactccacc
tcctga

DBGET integrated database retrieval system