KEGG   Maylandia zebra (zebra mbuna): 101487989
Entry
101487989         CDS       T02814                                 

Gene name
rela
Definition
(RefSeq) transcription factor p65 isoform X1
  KO
K04735  transcription factor p65
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
mze04137  Mitophagy - animal
mze04210  Apoptosis
mze04218  Cellular senescence
mze04620  Toll-like receptor signaling pathway
mze04621  NOD-like receptor signaling pathway
mze04622  RIG-I-like receptor signaling pathway
mze04623  Cytosolic DNA-sensing pathway
mze04625  C-type lectin receptor signaling pathway
mze04920  Adipocytokine signaling pathway
mze05132  Salmonella infection
mze05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101487989 (rela)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101487989 (rela)
  09143 Cell growth and death
   04210 Apoptosis
    101487989 (rela)
   04218 Cellular senescence
    101487989 (rela)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101487989 (rela)
   04621 NOD-like receptor signaling pathway
    101487989 (rela)
   04622 RIG-I-like receptor signaling pathway
    101487989 (rela)
   04623 Cytosolic DNA-sensing pathway
    101487989 (rela)
   04625 C-type lectin receptor signaling pathway
    101487989 (rela)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101487989 (rela)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101487989 (rela)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101487989 (rela)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mze03000]
    101487989 (rela)
Transcription factors [BR:mze03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    101487989 (rela)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer CAP_N
Other DBs
NCBI-GeneID: 101487989
NCBI-ProteinID: XP_004567139
UniProt: A0A3P9BP61
LinkDB
Position
LG3
AA seq 611 aa
MDPGYGWSLTPLNQAPYIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTHPAIKV
HNYSGPLRVRISLVTKNSPYKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQCVKKK
DVNEAITCRLQTNNNPFNIPEAKVWEEEFDLNSVRLCFQASITLSTGELYPLEPVVSQPI
YDNRAPNTAELKICRVNRNSGSCKGGDEIFLLCDKVQKEDIEVRFFQDSWEGKGTFSQAD
VHRQVAIVFRTPPYRDTNLTEPVRVKMQLRRPSDREVSEPMDFQYLPSDPDEYRLSEKRK
RTGDMFQNLKLGPLLSSVTTPQDRQHLNPSRRKLTAKPQLLNPQAAAVVPTGPTGAKSHP
QYPFQPGQLFSEQTKVEASNMSAAPTNQWKMTALGSQPKANPVSSFSMNPSPATSTITST
SNQDYSTVNLSDLHEFFPNISSTITQQEPSASQVNLASSQTSNSFALQSTQFRGEPPLVD
DDIPDFPSFTEGQVPVNLDSLNMDDLEDLLNPQIVNHPSCQPTGPSGSSTAAQTSAASQN
TSDPASNPGSTWMNYPNSIVHLLQNEIMTDSRPNNNQMLEDFDELMSADEDRLISIFNSG
SQAGFVSGHPT
NT seq 1836 nt   +upstreamnt  +downstreamnt
atggaccctggatatggatggagccttaccccgctcaaccaggctccctacatagagatt
atcgagcagccaaagcaaagggggatgagatttaggtacaagtgtgagggacggtctgct
ggcagcattcccggagaaaaaagcaatgacaccactaagacgcacccagcaatcaaggtg
cacaactacagcggccccctgcgtgttcgcatctcattggtgacaaagaactcaccctac
aagcctcatcctcatgagctggttggaaaagactgcaaacacggctactatgaggctgac
ctgcaggagagacggatacacagttttcagaacctgggtatacaatgtgtgaagaagaag
gatgtaaatgaggccatcacttgtagactgcagacaaacaataacccctttaacattcct
gaggctaaggtgtgggaggaagagtttgacctaaattcagtccggctttgcttccaggcc
tccatcactctctctacaggggagctctatcctctggagcctgtggtatcacagcccatc
tatgacaacagggctccaaacacagcagagctaaagatctgcagagtcaaccgcaactct
ggaagctgcaaaggaggggatgaaatctttctgctgtgtgacaaagtgcaaaaagaggac
attgaggtgcgtttcttccaagactcttgggaggggaagggcactttctcccaagctgat
gtccacaggcaggtggccattgtgtttcgcactccgccctaccgtgacactaacctcact
gagccagtgagagtcaagatgcaactccggcggccctctgaccgagaagtcagtgagcca
atggacttccagtacctgccgtcagatccagatgaatacaggctgagtgagaagagaaag
cggacaggagatatgttccagaacctgaagctagggcccttgctatctagtgtgaccact
ccacaagatagacagcacctaaacccatcaaggagaaagctgacagccaagcctcaatta
ctgaacccacaagctgcagctgtggtgcccactggtcccactggggcaaaatcacatccc
caataccccttccaaccaggccagctattttctgagcagacaaaagtagaagcctccaac
atgtcagcagctcctaccaaccagtggaagatgacagccctgggctcccaaccaaaagca
aacccagtgtctagcttttcaatgaacccatcaccggccacctctaccatcacttccact
tccaatcaggactactcaacggtcaacctgtcagatcttcatgaattcttccccaacatt
tcctcgactatcacccagcaggagccctcagcttctcaagtaaacttggcctcttcacag
acaagcaactccttcgccctccagagcactcagttccggggagagccaccacttgttgat
gacgatatcccagatttccctagcttcactgaaggccaggtcccagtcaacctggacagc
ctcaacatggatgacttggaggatcttctgaacccccaaatcgtaaatcatccttcatgt
cagccgactggcccttcgggctcctctaccgctgcccagactagtgcagcatctcagaac
acttctgaccctgccagcaacccaggaagcacttggatgaattaccccaacagcattgtg
catctgctccagaacgaaatcatgacagacagcagacccaataacaaccaaatgctcgaa
gacttcgatgagttgatgtctgctgatgaggaccgtcttatttccatttttaacagtgga
agccaagctgggtttgtgtcaggacacccgacttaa

DBGET integrated database retrieval system