KEGG   Maylandia zebra (zebra mbuna): 105941017Help
Entry
105941017         CDS       T02814                                 

Gene name
hk1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00010  Glycolysis / Gluconeogenesis
mze00051  Fructose and mannose metabolism
mze00052  Galactose metabolism
mze00500  Starch and sucrose metabolism
mze00520  Amino sugar and nucleotide sugar metabolism
mze00524  Neomycin, kanamycin and gentamicin biosynthesis
mze01100  Metabolic pathways
mze01200  Carbon metabolism
mze04910  Insulin signaling pathway
Module
mze_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mze_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105941017 (hk1)
   00051 Fructose and mannose metabolism
    105941017 (hk1)
   00052 Galactose metabolism
    105941017 (hk1)
   00500 Starch and sucrose metabolism
    105941017 (hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    105941017 (hk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    105941017 (hk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    105941017 (hk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mze04131]
    105941017 (hk1)
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     105941017 (hk1)
Membrane trafficking [BR:mze04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    105941017 (hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 105941017
NCBI-ProteinID: XP_012775902
LinkDB All DBs
Position
LG1
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYSMRFSDETLLDITQRFRKELVTGLGRDTNATAT
LKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESEIYDTPEDIIH
GTGARLFDHVAECLGNFMEKHNIKDKKLPVGFTFSFPCQQTKLDEGFLITWTKRFKASGV
EGMDVVQLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCVNTEWGAFGDDGRLEDIRTEFDREIDRGSLNPGSQLFEKMVSGM
YMGELVRLILVKMAREGLLFEGRITPELLTKGKIETKHVSAIEKSKEGLIKAREILNKLG
LEPSADDCIAVQHVCAIVSFRSASLVAATLAGILMRLKENKGASRLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPDCDVRFLLSESGSGKGAAMVTAVAYRLAEQSRQIAQILSEFSLT
TEQLLEVKQRMKIEIQNGLSKSTQDIATVKMLPTFVQSTPDGTEHGDFLALDLGGTNFRV
LLVKIRSGKRRSVEMHNKIYAIPLEVMQGTGEELFDHIVHCISDFLDYMGMKNARLPLGF
TFSFPCRQTSLDAGILVTWTKGFKATDCEGEDVVGLLRDAIRRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIAGTGSNACYMEEMKNVEMIEGDEGQMCVNMEWGAFGDNGCLDD
IRTEYDRSVDDFSLNPGKQRYEKMISGMYLGEIVRNILIDMTKKGFLFRGQISETLKTRS
IFETKFLSQIESDRLALLQVRSILQHLGLDSTCDDSIIVKEVCGTVSRRAAQLCGAGMAA
VVDKIRENRGLDHLDITVGVDGTLYKLHPHFSLIMHQTVKELAPNCNVKFLLSEDGSGKG
AALITAVGCRLRQELNSK
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgattgcggctcagctactagcctattacttcactgagctcaaggatgaccaggttaaa
aagatcgataagtacctgtactccatgcgtttctctgatgagacgttactggacatcacg
cagcgatttcgcaaggagctggtcacaggactgggtcgggatactaacgccactgctaca
ctgaagatgctgccaacatttgtacgctcaatccccgatggatcagagaaaggagacttc
attgcactcgatttgggaggcagcaacttcagaatcctccgcgtcaaagtgagccatgag
aagaaacagactgtgcagatggagagtgaaatctacgacacgcccgaggatattattcac
ggcactggagcgagactgtttgaccatgtggcagagtgtcttggtaacttcatggaaaaa
cacaacatcaaagacaagaaacttccagttggtttcaccttctccttcccctgccagcag
accaaactggatgagggctttctgataacatggactaagcgtttcaaggccagtggagtg
gaggggatggatgttgtccagctgcttaacaaagccatcaagaaacgaggggactatgag
gctgacattatggcagtcgtaaatgacactgtgggaacaatgatgacctgcggctttgat
gaccagcgctgtgaagtcggcattattatcggtacaggtactaatgcatgctacatggag
gagctgcgtcacattgacctggtggagggagacgagggcaggatgtgcgtgaacactgag
tggggagccttcggggacgacggcaggctggaagacatcaggactgagtttgacagggag
atagacagaggctctctcaacccaggcagccagctatttgagaagatggtcagtgggatg
tacatgggggagctggttcgcctcatcctggtgaagatggccagagaaggcttgctgttt
gagggaaggatcacccccgagctgctcactaaaggaaagatcgagaccaagcacgtctca
gccatagagaagagcaaggaagggttgatcaaggcgagagagattttgaacaaactgggt
ttggagccatcagcggacgactgcattgctgtgcagcatgtttgtgccattgtgtctttc
cgctccgccagccttgtagctgctactctggccggcatcctgatgaggctgaaggagaac
aaaggagcgtcacgtctccgaaccactgtaggcatcgatgggtctctctacaagatgcac
ccacaatatgcccgtcgtcttcacaagacagtcagacgtttggtcccggactgcgatgtt
cgattcctcctctcggagagcggcagtggaaagggtgctgccatggtgaccgctgtggcc
tacagactcgctgaacaatcgcgacaaatcgcccaaatactgtccgagttttccctgacg
actgaacagctgctggaggtgaagcagagaatgaagatagagatccaaaatggcctttct
aaaagcacacaggacattgccacagtcaaaatgctgccaacctttgtgcaaagcactcct
gacggcacagaacatggtgatttcctggctttagatttaggaggaaccaacttcagagtt
ctgttggttaaaattcgctctgggaagaggagatcagtggagatgcacaacaaaatctac
gctattcctctcgaagtgatgcagggcacaggggaggagttgttcgatcacatcgtgcac
tgtatcagtgacttcctggactacatggggatgaagaatgcccgtcttcctctgggcttc
accttctccttcccctgccgacagaccagcctggacgctggcatcttggtgacatggacc
aaaggcttcaaggcgacagactgcgaaggggaagatgtggtgggactgttgagggacgcc
attaggaggagagaggaatttgatctggacgtggttgctgtagtgaatgatacagtggga
accatgatgacctgtgcctatgaagaacccacctgtgaagttggtcttatcgccggtact
ggcagtaatgcgtgttacatggaagagatgaagaacgttgagatgattgagggcgatgag
ggtcagatgtgtgtcaacatggagtggggagcttttggagacaacggatgcctggacgac
atcaggacagagtacgaccgttctgtggacgacttctccctaaacccggggaaacaaaga
tatgagaaaatgatcagcggcatgtacctcggtgaaatcgtgcggaacatcctcatcgac
atgaccaaaaaaggattcctgttcagaggacagatttctgaaacactaaagaccagaagc
atctttgaaacaaagttcctgtcacagatagaaagtgacagattggctttgctgcaggtg
cgatcaatcctgcaacacttgggcctggacagcacctgtgatgacagtatcatagtcaaa
gaggtttgtggaacagtgtcacgtcgtgcagctcagctatgtggcgcaggaatggcggca
gtggtcgataagattagagagaaccgtggactggaccatttggacatcaccgtaggggta
gacgggaccctgtacaaattacatccacacttctccctgatcatgcaccagacggttaaa
gaactggctccaaactgtaatgtcaagttcttgctgtcagaggatggaagtggaaaagga
gctgcactcatcacagccgtgggctgccggctaagacaggagctgaacagcaaatag

DBGET integrated database retrieval system