KEGG   Maylandia zebra (zebra mbuna): 112433005Help
Entry
112433005         CDS       T02814                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00562  Inositol phosphate metabolism
mze01100  Metabolic pathways
mze04068  FoxO signaling pathway
mze04070  Phosphatidylinositol signaling system
mze04115  p53 signaling pathway
mze04140  Autophagy - animal
mze04150  mTOR signaling pathway
mze04218  Cellular senescence
mze04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112433005
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112433005
   04070 Phosphatidylinositol signaling system
    112433005
   04150 mTOR signaling pathway
    112433005
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112433005
  09143 Cell growth and death
   04115 p53 signaling pathway
    112433005
   04218 Cellular senescence
    112433005
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112433005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mze01009]
    112433005
Enzymes [BR:mze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112433005
    3.1.3.48  protein-tyrosine-phosphatase
     112433005
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     112433005
Protein phosphatases and associated proteins [BR:mze01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    112433005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 112433005
NCBI-ProteinID: XP_024657138
LinkDB All DBs
Position
Unknown
AA seq 437 aa AA seqDB search
MAALIRIRGIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLD
SKHKNHYKIYNLCAERHYDSSKFNCQVAQYPFEDHNPPQLELIKPFCEDLDKWLSEDEQH
VAAIHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTHDKKGVTIPSQRRYVVYY
NFLLKNQLQYKPVALLFHKMLFETIPMFTGGTCSESRAVSLLSLRATSVELTGVPVLPAD
PQFVVYQLKVKIHTSNPGHTRREDKLMLFEFPQPLPVCGDIKVEFFHKQNKVLKKEKMFH
FWINTFFIPGPEEVPERMENGSAGTPRELFDRTPQTPMTPGSETNDRDYLVLTLTKNDLD
KANKDKANRNFSPNFKVKLFFTKTVEEGANCDASSTSSMTPDASDNEPDHYRYSDTTDSD
PENEGFEDEDHNQITKV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggctgccttaatcagaatccgggggattgtgagcaggaacaaaaggcggtaccaggag
gacggcttcgacctggacctgacctacatttatccaaacatcatcgcgatgggtttcccc
gccgagcggctggagggcgtttacaggaacaacatcgacgacgtggttcggtttttagac
tcgaagcacaagaatcactataagatctacaacctatgtgcggagcgacattacgactca
tcaaagttcaactgccaagtcgctcagtacccgttcgaggaccacaacccgccccagctg
gagctgataaagccgttctgcgaggacctggacaagtggctgagcgaggacgagcagcac
gtcgccgccatccactgcaaggcgggaaagggccgcaccggcgtgatgatctgcgcctac
ctgctgcaccggggcaagttccaggaagctcaggaggccctcgacttctacggggaggtc
cgcacccacgacaagaagggtgtgaccatcccgagccagcggcgctacgttgtctactac
aacttcctgctgaagaaccagctgcagtacaaaccggtggctctgctcttccacaagatg
ctgtttgaaaccatccccatgttcaccggaggcacctgcagtgagtctcgagcagtaagt
ctgctgtcgcttcgagcgacttcagttgaattaacgggtgtccctgtgctccccgcagac
ccccagtttgtcgtgtaccagctgaaggtgaagatccacacctctaaccccggccacacc
cgcagggaagacaaactgatgctgtttgagttcccgcagccacttcctgtctgtggagac
atcaaggtggagttcttccacaagcagaacaaggtgctgaagaaggagaagatgttccat
ttctggatcaacaccttcttcatcccgggtccggaggaagtcccagagaggatggagaac
ggcagcgcggggacacccagagagctgtttgacaggacgccgcagaccccgatgacgccg
ggaagcgaaaccaacgacagagactacctggtcctcacgctgaccaagaacgacctggac
aaggccaacaaggacaaggccaacaggaacttctccccgaacttcaaggtgaaactgttc
ttcaccaagacggtagaagaaggagccaactgtgacgcgagcagcacgtcctcgatgacg
ccagacgccagcgacaacgaaccggatcactaccgctactcggacacgacggactcggac
cctgagaacgaggggtttgaagacgaagaccacaatcagatcacaaaagtctga

DBGET integrated database retrieval system