KEGG   Methanosalsum zhilinae: Mzhil_0372Help
Entry
Mzhil_0372        CDS       T01541                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
mzh  Methanosalsum zhilinae
Pathway
mzh00970  Aminoacyl-tRNA biosynthesis
mzh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mzh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mzhil_0372
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mzh03029]
    Mzhil_0372
Enzymes [BR:mzh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Mzhil_0372
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Mzhil_0372
Mitochondrial biogenesis [BR:mzh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Mzhil_0372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AEH60247
UniProt: F7XPC0
LinkDB All DBs
Position
complement(421009..422436)
Genome map
AA seq 475 aa AA seqDB search
MPEWINISGIKEKVTDTSAEEVTLSYIEKIGNSRTYGFSAINERAAEHAKEIDSGKTDLP
LAGVPIAIKDNISTLGIPTTCSSKILEGYIPPYNAHVIERLVDAGAVILGKTKMDEFAMG
SSTETCCGGPALNPWDTERVPGGSSGGSAAAVASGETPVALGSDTGGSVRSPASFCGIVA
LKPTYGTVSRYGLIAYANSLEQIGPMGTCVKDVATVMDVIAGHDPRDSTSIKRDIEYSKT
IENDVNGMKIGIPEEYLSDGINPQVNKCVWDAIHKMEDLGATWKSVSLPHTKYALSSYYI
IAMSEASSNLARFDGTRYGLRAEGENWHVMASRTRAEGFGDEVKRRILLGTYALSAGYHD
KYYLKALKVRTLVKEDFDRALSEVDVLMGPTMPDIAFKLGEKIQDPLSLYLTDVNTVPVN
LAGVPSISVPCGFANKMPVGLQIIGRHFDEASILRTAYTFEQNTDHHKKRPDGVK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgccagaatggataaacatctccgggatcaaagaaaaagtcactgacacatcggcagaa
gaagttaccctatcctatatagagaaaatcggaaatagcaggacatatggattttcagca
ataaatgaaagggcagcagagcatgcaaaagaaatagattccggaaagaccgatttacca
cttgccggggttcccatagctatcaaggataacatttcaactctgggtatacccaccaca
tgttcttcaaagatactggaaggatatattccgccatacaatgctcatgttatagaaaga
cttgttgatgctggtgccgtgattcttggaaaaacaaaaatggatgaatttgcaatggga
agctctactgaaacatgctgtggaggcccggcactcaacccctgggatacagaaagagta
cccggaggatcatctggtggtagcgctgcagcagtagcttcaggtgaaactcctgtagca
ctgggatcagatacaggaggatcagtgcggtcgccagcttctttttgtgggatcgtcgca
ctcaagccaacctatggtactgtttcaagatatggccttatcgcctatgccaattccctt
gaacagatcggacccatggggacatgtgtaaaggatgtggcaactgttatggatgtcata
gcaggtcacgacccacgtgatagcacatcgatcaaaagggacatagaatattcaaaaacc
atagaaaacgatgtcaatggcatgaagatagggattccggaagagtatctttcagatggg
atcaatccccaggtgaataaatgtgtctgggacgcaatacataaaatggaagacctgggc
gctacatggaaaagtgtttcattaccccatacaaaatacgccctttcatcatactatatc
atagccatgagtgaagcctcatctaatcttgcacgttttgatggaacacgctacggactt
cgtgcggaaggtgaaaactggcacgttatggcgtcaagaaccagagctgagggttttggg
gatgaggttaaaagaaggattctgcttggaacctatgcactctctgccgggtatcatgat
aaatattacctcaaggcactgaaggtcaggacacttgtaaaggaagattttgatcgggca
ttatcggaggtagatgttctgatgggaccaacaatgcctgatatcgcattcaagctcgga
gaaaaaatccaggatccactttctctctatcttacagatgtaaatactgtcccggtaaat
ctcgcaggagttccctctatctcggtaccctgtggttttgcaaacaagatgccagtgggt
cttcagataataggaaggcactttgatgaagcatccatcctgagaactgcatataccttt
gaacagaatactgatcaccataaaaaaagaccagatggagtgaaataa

DBGET integrated database retrieval system