KEGG   Methanosalsum zhilinae: Mzhil_1028
Entry
Mzhil_1028        CDS       T01541                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase NAD-binding protein
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mzh  Methanosalsum zhilinae
Pathway
mzh00300  Lysine biosynthesis
mzh01100  Metabolic pathways
mzh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mzh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Mzhil_1028
Enzymes [BR:mzh01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     Mzhil_1028
SSDB
Motif
Pfam: F420_oxidored 3HCDH_N NAD_binding_7 NAD_binding_2 TrkA_N adh_short 2-Hacid_dh_C UDPG_MGDP_dh_N AlaDh_PNT_C ApbA Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: AEH60885
UniProt: F7XLV7
LinkDB
Position
1123379..1124182
AA seq 267 aa
MALLTPEDLENLLDKLEYNEKVIKKVTGFEIKQICEETYGTFPDSEVVGIVPVTSGNGII
DNFTASLAAIVNHFGLKGFVTEHTDISGYNEAVSRRADIIMMADDHIFIAHNLKNGKIST
NHECTGIIYSEIAARYLHADSTDILVIGLGRVGYAGASHLAKKGFNVYACDPNIEFLEKA
VKELGVKPYERNSGKKFSMIMEATPCKDTISEGMVSDRCLVSTPGIPCGLPENIGKKYKV
DMVMEPLVIGVASMLYSVFDETAKFND
NT seq 804 nt   +upstreamnt  +downstreamnt
atggcacttctaacacctgaagatctcgaaaaccttttagataaacttgaatataatgaa
aaggtcataaaaaaagtgaccggttttgaaataaagcaaatatgtgaagagacatatggt
acatttccagattctgaggttgtaggaattgtcccggtaacttctggaaatggaattatt
gacaactttacggcttcacttgctgcgattgtgaatcatttcggactgaaaggattcgtt
acagagcatactgacatatccggatataatgaagctgtaagcagaagagcagatataata
atgatggcagacgaccatatttttattgcacataatctgaagaacggaaagatatccact
aatcatgaatgtacaggaatcatctattccgaaatagcagccagatacctgcatgcagat
tcaactgatatacttgttatagggcttggaagggttgggtatgccggtgcctctcatctt
gcaaaaaagggatttaacgtgtatgcatgcgatccgaatattgaattcctcgaaaaagca
gtaaaggaacttggggtcaagccctatgaaagaaatagtggaaagaaattttcaatgatc
atggaagcaaccccatgcaaggatacaatatctgaaggaatggtttcagatagatgcctg
gtgtccactcctggaattccgtgtggacttccggaaaatataggtaaaaaatataaagta
gatatggtaatggaacctcttgttattggagttgcttcaatgctctactcggtatttgat
gaaaccgcaaaatttaatgactag

DBGET integrated database retrieval system