KEGG   Methanosalsum zhilinae: Mzhil_1998Help
Entry
Mzhil_1998        CDS       T01541                                 

Definition
(GenBank) chromosome segregation protein SMC
  KO
K03529  chromosome segregation protein
Organism
mzh  Methanosalsum zhilinae
Brite
Chromosome and associated proteins [BR:mzh03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Condensin-like complex
    Mzhil_1998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N SMC_hinge AAA_23 Spc7 IncA Reo_sigmaC MscS_porin AAA_21 EzrA AAA_29 CENP-F_leu_zip IFT57 Lebercilin PspA_IM30 TPR_MLP1_2 AAA_13 AAA_15 DUF1664 Uso1_p115_C Filament T3SSipB ATG16 Nup88 TolA_bind_tri Tropomyosin_1 Golgin_A5 GAS DUF3584 FliJ CCDC-167 DUF724 APG6 Laminin_I Baculo_PEP_C Ribosomal_S15 Laminin_II DUF4200 DUF812 TMPIT TACC
Motif
Other DBs
NCBI-ProteinID: AEH61831
UniProt: F7XKW1
LinkDB All DBs
Position
complement(2107201..2110725)
Genome map
AA seq 1174 aa AA seqDB search
MYIKQIEFTNFKSFGKKVRIPFFDDFTTISGPNGSGKSNIIDGILFALGLSSSRTLRAEK
LTDLIYNDGNKNKRPDFAQVSIVFDNTDREMPVDADQVTITRKIRETDSGYYSYFYFNGK
PVSLSDVHNILSKARVTPEGYNVVMQGDVTRIITMTPTERRKIVDEIAGVSEFDNKKERA
LNELEIVRERIERVDIIIDEVGTQLEKLRGERDQALKYRSLRQEKMKYEGFVLLSKLKDA
RSELTAVKDEIDCRKGSLEELQSLMEQASQKLETAENELEELTETIRKMGEDEQIQIKKD
IEEIRGEISRCSGSIELTESEIEDIDSRRRKVFVEIDEDKNRINELESRISENTLRKESL
NDQIGEHRTEYRLVMSKIAEIDSKFASTRDELSSLKSELEDLKNRKSELLREEDRLLDAL
RRRSAEVREIENEIDDAKSKVESSDSDTRSIKYEIEKLTEKINTLTQDMDDLESNRSQIK
KVVTELEDTLRKYQQEYALVEARVRAAEDSGNYSKAVDIVLDARKKKVLPGIYGTIAELG
KVDQKYATALEIAAGGRMQAVVVETDEDGAGAIDYLKSRRGGRATFLPLNRMEARRPYKD
LSDREGVVGYAIDLIDFDPRFEAAFWYVFRDTLVVDNLKNARRLMGGLRMVTLDGETIEK
SGAMTGGFRQSSRLSFAAAEKEKLVKLAEQITEYDSRRNTALKKMDSVEAHISSTRKEID
DLEKMISRKEMQLEEIAGRGERLAGLIESRNQELEEIESAQKKLREQMDAVVSERNEIEE
NIKSLTDRIEDLEKKLSSSQIPEFNKRAESIDEEIKRLEDRVRDIDSQINALRLDHEYAQ
KKIEDNRNLIKDLEDRKSEYRDRIVSLGKKIEELESLLAEKQNKESQISENLAEARKRRE
QKQSEYRNIKSEFEAARSRFEDAQREMTALESTRDALTEQISELITELERRGVEETDDVP
GYEAVRTRISSIERAMEKMEPVNMRAIEEYDNVKSRLSELEQRRDILFNEREEILIRINQ
YEKFKKEAFMDSYNGINEHFKNIFNELSDGRGELVLDNYEDPFSGGLTLKAQPKDKTLQR
LEAMSGGEKSLTALAFVFAIQQYRPAPFYAFDEIDMFLDGSNAERVAQRIKKSGTYAQFI
VVSLRKPMIEAASRTIGVAMQDNNITSITGVKLR
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
gtgtatatcaagcaaatagagtttacgaatttcaaatcttttggtaaaaaggtcagaatc
cctttttttgatgacttcactaccatttccggcccaaacggaagtggtaaatccaatatc
atagacggtatactgtttgcactgggactttccagttcaaggaccctgagagcagagaaa
cttacagatctgatctataatgatgggaataaaaataaaagaccggattttgctcaggtt
tcaatagtttttgacaatactgatcgtgaaatgcctgttgatgcagaccaggtaacaatt
acccgcaagatcagggagacggacagtggatattacagctatttttattttaatggaaaa
cctgtaagcctttcagatgttcataatattctttccaaagcaagggtcactccggaaggc
tataatgtagttatgcagggtgatgtaacccgtataattacaatgactcctacagagcgc
cgtaaaatagttgatgagatagcaggtgtttctgaatttgacaataaaaaggaaagggcc
ctaaatgaactggaaattgtcagggagagaattgagagggttgacatcataatagacgag
gtgggtacacagcttgagaaattaagaggtgaaagggaccaggcgctcaaatacagatca
ctaaggcaggagaaaatgaagtatgaaggttttgttctcctgtccaaactcaaggatgcc
agatcagaactaactgcggtaaaagatgagatcgattgcagaaagggttcactggaagaa
cttcaaagtctgatggaacaggcttcgcagaaactggaaactgcagagaatgaacttgag
gaactgacagaaaccatcaggaagatgggtgaggatgaacagatacagatcaaaaaagac
attgaggagataaggggagaaatttcgagatgtagtggcagtattgaacttactgaaagt
gagatcgaggatattgattcccgcagaagaaaggtatttgttgagatagatgaagataag
aacaggatcaatgaactggaatccaggatatcggaaaatacgcttagaaaggaaagcctg
aatgatcagattggagagcacaggactgagtacaggctggtgatgagcaagattgcagaa
atcgattcaaaatttgcaagtaccagggatgagctctcatcactcaaatctgaactggaa
gatctcaagaacagaaaaagtgaacttctaagagaagaggaccgtctgttggatgcactc
aggcgcaggtctgcagaggtcagggagattgagaatgagatcgatgatgcaaaatcaaag
gttgagtcctccgacagtgatacccgttcaataaaatatgaaatcgaaaaactcactgaa
aaaatcaatactcttacacaggatatggatgatctggagagcaacagatcccagataaaa
aaggttgttactgagctggaagatactctgcgcaagtaccagcaggaatatgcacttgta
gaagcccgcgtcagggctgctgaagattccggtaactattcaaaagctgtggatatagtt
cttgatgcacgtaaaaagaaggttcttccaggtatctatggaactattgcagagcttgga
aaggtggaccagaaatatgccactgctcttgaaatcgctgctggtggacgcatgcaggca
gttgtggtggaaaccgatgaggatggggcaggtgctattgattatctaaagagcagaaga
ggtggaagggcaacatttcttccactaaacaggatggaagccagaagaccctacaaggat
ctctctgacagagaaggcgttgttggatatgccattgacctgatagactttgatccaaga
tttgaggcagctttctggtatgttttcagagatactctggttgttgataacctgaaaaac
gcaagacgcctgatgggtggtttgcggatggttacccttgatggagagactatagaaaag
agtggagccatgacaggcggattcaggcagagttcaagactgtcctttgctgctgctgaa
aaggagaaactggtaaaactggcagaacagattacggaatacgactccaggagaaatacc
gctttaaaaaagatggactctgtggaagctcatatctcatctaccagaaaggaaattgat
gacctggaaaaaatgatatcaagaaaggaaatgcagcttgaagagattgcagggcgtggt
gagaggctggcaggtctgatagaatcccgaaatcaggaacttgaagagattgaatctgca
cagaaaaagttgcgggagcagatggatgctgtagtctctgaaaggaacgaaattgaagag
aatatcaaatcacttacagaccggatagaggacctggaaaagaaactgtccagttctcag
attccggaatttaacaaaagggctgaaagtattgatgaagagattaaaaggctggaagac
agggttcgggatatagattcccagatcaatgctctgcgtcttgaccatgagtatgcgcag
aaaaaaattgaagataacaggaatctgatcaaagaccttgaagatagaaagtcagagtac
agggatcgcatagtttcccttggtaaaaagatcgaagaacttgaatctcttctggcagaa
aagcagaacaaggagagccagatatctgaaaatcttgcagaggcccgtaaaagaagagaa
cagaagcagagtgaataccgcaatatcaaatctgagttcgaagctgccaggtccaggttc
gaagatgcacaaagagaaatgacagctctggaatctacccgtgatgccctgacagagcag
ataagtgaactgatcactgaactggagagaagaggtgtggaggaaaccgatgatgttcct
ggctatgaagctgtaaggacaaggatttcatctatagaaagagctatggaaaaaatggaa
cctgtaaacatgcgtgccattgaggaatatgataatgtgaaatcaagactttctgaactg
gagcagagacgggatattctgttcaatgagagagaagagattctgatccgcataaaccag
tacgagaaattcaagaaagaggcgttcatggattcttacaatggtatcaatgaacatttc
aaaaatatattcaatgaactctcggatggcagaggtgaactggttctggacaactatgaa
gaccctttcagcggtgggctaaccctcaaggcccagcctaaggataaaaccctgcaaagg
cttgaagccatgtcaggtggtgaaaaaagcttaactgcccttgcatttgtttttgcaata
cagcaatacagaccggcaccattttatgcatttgatgaaattgatatgttcctggatgga
tcaaatgcagaaagggtggcccagcgtataaagaaatccggaacctatgcccagtttatt
gtggtatccctcagaaagccaatgatagaggcagcttcaagaacaataggagttgcaatg
caggataataacattacaagtattacaggtgtgaaattgcgttga

DBGET integrated database retrieval system