KEGG   Candidatus Nanopelagicus abundans: B1sIIB91_04815Help
Entry
B1sIIB91_04815    CDS       T05091                                 

Definition
(GenBank) nickel superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
nab  Candidatus Nanopelagicus abundans
Brite
KEGG Orthology (KO) [BR:nab00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B1sIIB91_04815
Enzymes [BR:nab01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B1sIIB91_04815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N DUF2937
Motif
Other DBs
NCBI-ProteinID: ASY24213
UniProt: A0A249L5A4
LinkDB All DBs
Position
930775..931182
Genome map
AA seq 135 aa AA seqDB search
MLDSLLKLITPKESVYAHCDLPCGVYDPAQAKIEAQSVKACMEKYASSSDPDFKSRAVAI
KEVRSELVKHHLWVLWTDYFKPNHFEAHPQLHTLFNEATKLAGAGGSKGTNDVAVADKLI
KKIDEISEIFWATKK
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgctcgattcattacttaagttaattactccaaaagagagcgtatacgcccactgcgat
ctaccttgtggcgtttatgacccagcgcaagcaaagatagaggcacaatctgttaaggct
tgtatggagaagtacgcaagtagcagtgatcctgattttaaatcacgggcggttgcaatt
aaagaagtgcgatctgaattagttaagcaccacttatgggttttgtggacagattacttc
aaaccaaaccattttgaggcacatccacagcttcacactttatttaatgaggcaaccaaa
cttgctggtgctggtggcagtaagggcacgaatgatgttgcggttgcagataaattaatt
aagaaaattgatgaaatttctgaaatattttgggcaactaaaaagtaa

DBGET integrated database retrieval system