KEGG   Nanohaloarchaea archaeon SG9: AQV86_01200Help
Entry
AQV86_01200       CDS       T04498                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nac  Nanohaloarchaea archaeon SG9
Pathway
nac00010  Glycolysis / Gluconeogenesis
nac00020  Citrate cycle (TCA cycle)
nac00620  Pyruvate metabolism
nac01100  Metabolic pathways
nac01110  Biosynthesis of secondary metabolites
nac01120  Microbial metabolism in diverse environments
nac01130  Biosynthesis of antibiotics
nac01200  Carbon metabolism
Module
nac_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AQV86_01200
   00020 Citrate cycle (TCA cycle)
    AQV86_01200
   00620 Pyruvate metabolism
    AQV86_01200
Enzymes [BR:nac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AQV86_01200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N AATase GCV_H HlyD_D23 NQRA HlyD_3
Motif
Other DBs
NCBI-ProteinID: AOV94525
UniProt: A0A1D8MRE5
LinkDB All DBs
Position
complement(194336..195733)
Genome map
AA seq 465 aa AA seqDB search
MSLEFEFPDTGEGVTEGKFLDWKIEEGDKVEEDQVIAEAETDKAVVEIPAPADGVVKNFK
ASPGDRVEVGQVILEMETEENIEEGPEEEIGEGEEETPENSKASSTDFSSSTSGDVLALP
KVRKLAEEKGIELGDIKTGERITEEELIEYAEKGKSEASEEIFDGSSKVPGESRGLNASP
SVRRLAREKGLDISEIDGSGRGGEVLRNDVLEAAKDESSGNERPSSETHSVETGEGEVER
VEMNQVKKMTGSKMEKARFTAPHVTHMDTADVTKLVKLRESVKDDISEHLTYLPFIMKAC
YVAMKDHPDLNAELDEEKDEIVRKKYYDFNIAVDTDRGLLVPKIEEVDEKNLVELASGIS
DLVDKAQGGDISPGEMQGGTFSITNIGAIGGEGFTPIINYPQVAILGVGKIQETPEVVDG
EIQVRNTLKLSLSYDHRVIDGAEAARFMNNVIENLEEPEEMLMEI
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagtctagagttcgaatttccagacaccggtgaaggagtcactgagggaaaattccta
gactggaagatagaagaaggcgacaaagtcgaagaagaccaggtaatagccgaagcagaa
accgataaagcagtagtggagatcccagcaccggcagacggcgtcgtgaaaaatttcaag
gcctcaccgggagacagagttgaagtcggccaggtaatactcgaaatggagacagaggaa
aacatagaagaaggccctgaagaagaaattggggaaggggaagaggaaactccagagaat
tcaaaggcctcgtctacagatttcagttcttcaacctctggagatgttctggcactgcct
aaggtccggaagcttgccgaggaaaaaggaatagaacttggagatatcaagacaggcgaa
aggataacagaggaagaattaatcgaatacgcggaaaaaggaaaatctgaggcctcggaa
gagatttttgacggcagttcaaaggttccaggcgaaagcagggggttgaatgcctctcct
tctgtcagaagactggcacgggagaaaggcctcgatatttcagagatagatggttccgga
cgtggcggcgaagtcctgagaaacgatgttctggaggctgcaaaggacgagagttctgga
aatgaaaggccttcatcggagactcattcagtggagactggagaaggcgaggttgaacgt
gtagagatgaaccaggtcaaaaagatgactggttcgaagatggagaaggcaaggtttaca
gcaccgcatgttacccatatggatactgcagatgtcacgaagctcgtcaagctgcgggag
agcgtaaaggatgatattagcgagcatctgacgtatcttcctttcatcatgaaggcctgt
tacgttgccatgaaagatcatccggatctgaacgcggagcttgatgaggaaaaagatgaa
attgtcaggaagaagtactacgacttcaatatagctgtcgatactgatagaggccttctt
gtgccgaagatcgaagaggttgatgagaagaacctggttgaactggcttccggtatctcg
gatcttgtggataaggcccagggcggagatatttctccgggtgagatgcagggaggaacg
ttctcgattacgaatatcggtgcgattgggggcgaaggcttcactccaataattaattat
ccgcaggtagcgatcctgggggttggaaagattcaggaaactcctgaagttgtcgatgga
gaaatccaggtgagaaataccttgaaactctcacttagctacgatcacagagtcatagac
ggcgcagaagctgctcgctttatgaacaatgtaattgaaaatcttgaggagcctgaagag
atgcttatggagatttaa

DBGET integrated database retrieval system