KEGG   Nanohaloarchaea archaeon SG9: AQV86_01540Help
Entry
AQV86_01540       CDS       T04498                                 

Definition
(GenBank) hypothetical protein
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
nac  Nanohaloarchaea archaeon SG9
Pathway
nac00500  Starch and sucrose metabolism
nac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AQV86_01540
Enzymes [BR:nac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AQV86_01540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57
Motif
Other DBs
NCBI-ProteinID: AOV94591
UniProt: A0A1D8MRF8
LinkDB All DBs
Position
complement(256791..258008)
Genome map
AA seq 405 aa AA seqDB search
MLPVSLSFEVHQPHRLRTEGVNEEASTLYGRYFDDEMNEHFFRDVAENCYFPATERLLRN
AKKFEGEDREFKVNFSISSSWVEQAKKYHPELIDMLNQFPDGTVDFIGQTHYHSLSGLFH
DKSEFRWQLGKHRDIIEHTFGRRPQVMTNTELIYHNEIGKVAAEEGYDGIFTEGAPRMLG
WRSPNHAYTQPDFVTEEGNNILLRNRKLTDDVGYRFSAEWWNEYPLTAEKYALWLSNASG
DMLNLFMDYETFGEHHWEGTGILWFLEDLPQQVFEHDNLKFSTVREIAENSDPVGKFDAF
EYNTVSWADQEMDASAWLGNKMQKMLFQRLQDIEEKVRAIDDEEVTDVWRKFLTSDHLHH
IATKSMEDGSVHNYFSYFNHPHQGFAVITEHLMDFQQQVEKRYRR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcttcccgtatccctgagcttcgaggtacatcagcctcaccgtttgaggacagaaggc
gttaacgaggaggcctcgaccctgtacggaaggtattttgatgatgagatgaacgagcat
tttttcagggatgtcgcggagaactgttatttccctgcgactgaacggcttctcaggaat
gcgaagaagtttgagggagaggaccgtgagttcaaggtgaatttctcgatctcgagttca
tgggtggaacaagcgaaaaagtatcatccagagcttatcgacatgctgaaccagtttccg
gatgggacagtcgatttcatcggtcagacacattaccattcgctttcaggccttttccat
gacaagagtgaattcaggtggcagttagggaagcatagggatattatagagcatactttc
ggtaggaggcctcaggtcatgactaatacagagttaatctaccataatgagatcggaaag
gttgctgcggaggaaggttacgacggtattttcacggagggtgctccgaggatgttaggc
tggagaagtccgaaccatgcctatactcagccggatttcgtgactgaggaagggaacaat
attttattgaggaacagaaaactgacggacgacgtcggctaccgtttctctgcggagtgg
tggaatgagtacccgttgacggcggaaaagtacgctctatggctttcgaacgcttctggc
gatatgctgaatcttttcatggattacgagacgttcggggagcatcactgggaagggacc
ggtattctctggttcctggaggatctaccccagcaggtcttcgaacacgataacctgaaa
ttctccactgtaagagaaattgcagagaacagcgatcctgtcgggaagttcgatgccttc
gagtacaatactgtctcatgggcagatcaggagatggatgcctctgcctggctcggcaac
aaaatgcagaaaatgcttttccagaggcttcaggatatcgaggaaaaagtcagggctata
gacgacgaggaagttacagacgtctggagaaagttcctgacaagcgatcacctgcaccat
atcgccaccaaatccatggaagacggcagcgtacacaactacttctcgtatttcaaccat
ccacatcagggattcgccgtcatcacagaacacctcatggacttccagcaacaggtagaa
aaaagatacagaaggtaa

DBGET integrated database retrieval system