KEGG   Nanohaloarchaea archaeon SG9: AQV86_03085Help
Entry
AQV86_03085       CDS       T04498                                 

Definition
(GenBank) hypothetical protein
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
nac  Nanohaloarchaea archaeon SG9
Brite
KEGG Orthology (KO) [BR:nac00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AQV86_03085
Enzymes [BR:nac01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AQV86_03085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 GIDA Pyr_redox HI0933_like NAD_binding_9 NAD_binding_7 FAD_binding_2 Shikimate_DH K_oxygenase Lycopene_cycl NAD_binding_8 FAD_oxidored AlaDh_PNT_C Thi4
Motif
Other DBs
NCBI-ProteinID: AOV94885
UniProt: A0A1D8MSD2
LinkDB All DBs
Position
complement(586056..586973)
Genome map
AA seq 305 aa AA seqDB search
MRDLIIIGGASAAQSAAIYAIRAGIEATVVADEYGGQINNTDKVENYLGIKSMGGPEMAE
KFVEHMREYDVEEKKGLRATEVRKKDDETFEVELEDGEVLESRAVVIATGGHRRKLDVKG
EEELTGKGVSYCAVCDGPLYQGEEVAVVGAGYAGTEAAAYLTDVVEKVHVINRSEGYSGE
EITIKQVREAENVEHHENAQIKEIYGDPMVEGLKYEKDGEKTDLEVAGAFIEIGTVPNSG
ISDLVETDEGGYINVNPEMETRTEGLYAAGDVTDLGEQQLVVSAGQGCQAGLNAAEYVKE
KKSES
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagagatttgattatcatagggggagcgtcggcagcacagtcagcagcaatatatgcc
ataagagcaggtatagaagcaactgtggtagctgacgaatacgggggacagataaacaac
acagataaagtggagaactacctgggcatcaaaagcatggggggcccggaaatggcagaa
aaattcgtcgaacacatgagagaatacgatgtagaggaaaagaaaggcctcagagctaca
gaagtaagaaaaaaagatgatgagacgtttgaagtcgagctggaagatggagaagtactt
gaatcaagagctgtcgtcatagcaactggtggacaccgcagaaaactcgatgtcaagggt
gaagaggaattaaccggcaaaggagtctcatactgtgcggtatgtgatggaccgctgtat
caaggcgaggaggtcgccgtagtcggagcaggatacgcaggaacagaagcggcagcctac
ctgaccgatgtcgtggaaaaagtacatgtcataaacaggagcgaaggatacagcggagaa
gaaatcaccataaaacaggtaagagaagccgaaaacgtagaacaccacgaaaacgcccag
ataaaagaaatatacggagatccaatggtggaaggcctcaaatacgaaaaagacggcgaa
aaaacggatctcgaggtcgcaggagcatttatcgagataggtacagtaccgaactcagga
atctcagatcttgtagagaccgacgaaggaggctacatcaacgtcaacccggagatggag
accagaacagaaggcctctacgctgcaggggacgtaacagacctcggtgaacagcagtta
gtggtttcagcaggacagggatgtcaggcaggattgaacgctgctgagtatgtcaaagag
aaaaaatcagagagctaa

DBGET integrated database retrieval system