KEGG   Neomicrococcus aestuarii: BHE16_04115Help
Entry
BHE16_04115       CDS       T04559                                 

Definition
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
nae  Neomicrococcus aestuarii
Brite
KEGG Orthology (KO) [BR:nae00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nae03016]
    BHE16_04115
Enzymes [BR:nae01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     BHE16_04115
Transfer RNA biogenesis [BR:nae03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    BHE16_04115
 Prokaryotic type
    BHE16_04115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C TruB_C_2 DUF2244 DKCLD ThiC_Rad_SAM
Motif
Other DBs
NCBI-ProteinID: APF40334
UniProt: A0A1L2ZLT2
LinkDB All DBs
Position
complement(937476..938402)
Genome map
AA seq 308 aa AA seqDB search
MGSKDTSTAPDSGQETAPGSGLVIVDKPQGFTSHDVVGKMRRLAQTRKVGHAGTLDPMAT
GVLIVGINKATRLLTYIVGASKTYEATIRLGESTVTDDAEGEITQTRIAAAVTREDIDRE
IAKLTGDILQVPSSVSAIKINGERAYKRVRSGEEVEIPARPVTIHRFDVHDVRRERAGKI
VDVDVTVECSSGTYIRALARDLGQALDVGGHLTALRRTAVGPYELEKARTLEQLAENFEY
LPLANAARALFENRELTEEEATELSFGRRIPRNETEEITAAFTPDGELAALLKNKGSKAV
PEIVFEAH
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgaaagatacctcgacagcaccggattcgggacaggaaactgctcccgggtcc
ggtcttgtcatcgttgataagcctcaaggtttcacgagtcatgacgtggtgggcaagatg
cgccgcctcgcgcagactcgcaaagtgggccatgccggaacgttggatccgatggccacc
ggtgttctcattgtggggatcaacaaagccacgcgcttgttgacctacatcgtgggagct
tcgaagacttacgaggcgaccatccgcttgggcgaatccaccgtgacggacgacgccgaa
ggtgagatcacccagacgcgtatcgccgcggcagtcacccgtgaggacattgaccgggag
attgctaagctcacgggcgacattcttcaggttccttcctcggtgagcgccattaagatc
aacggcgaacgcgcctacaagcgggttcgttcgggcgaagaagtcgagattccggcacga
ccagtgacgattcaccgcttcgacgtgcacgatgtgcgccgtgaacgcgctggaaagatc
gttgacgtcgacgtgacggtggagtgttcctcaggcacctacattcgcgcgctcgcgagg
gatctgggccaagccctcgacgtgggcggacacttgaccgcgcttcgtcggaccgccgtt
ggaccgtacgagcttgagaaggctcgaaccctcgaacaactcgccgagaactttgaatac
ttgccactcgcaaatgctgctcgtgcgctctttgagaatcgcgaactgacggaagaagaa
gccaccgagctttccttcggtcggcgaattccacgcaatgagaccgaagagatcaccgcc
gcgttcacgccggacggcgaactcgcagcattgctcaagaacaagggctccaaagctgtt
cctgagatcgtttttgaggcccactaa

DBGET integrated database retrieval system