KEGG   Neomicrococcus aestuarii: BHE16_06090Help
Entry
BHE16_06090       CDS       T04559                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
nae  Neomicrococcus aestuarii
Pathway
nae00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:nae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BHE16_06090
Enzymes [BR:nae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BHE16_06090
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BHE16_06090
    1.1.1.-  
     BHE16_06090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C FAD_binding_3 ADH_zinc_N_2 adh_short 2-Hacid_dh_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: APF40655
UniProt: A0A1L2ZMJ0
LinkDB All DBs
Position
complement(1391611..1392672)
Genome map
AA seq 353 aa AA seqDB search
MRAARYYDQKDIRIEDIPEMELLPGTVEIEVAWCGICGTDLHEYLEGPIFVPPAGHPHPI
SGESAPVTLGHEFSGTVTALGEGVTDLKVGENVVVEPYIINDDVDTSKGQSYHLSKDMNF
IGLGGRGGGLSEKIVVKRRWVHPIGDIPLDQAALIEPLSVGHHAFVRSEAKAGQVAIVGG
AGPIGLLTAAVLKAEGLTVYISELSEARKAKARETGVADDVFDPREVNVAEKVRELTGGK
GADVGFECSSVPVVLDMLLDAVKPGGVVVNVSIWGHKPAVDMPKIVLKEIDLRGTIGYAG
DHPDTIALVQSGKLDLAPFITGRIGLDELVSGGFEQLINNNEYHVKIIVNPKA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagggcagcacgttattacgatcagaaagacatccgcatcgaggacattccagaaatg
gaattgttgccaggaacggttgaaatcgaagttgcttggtgcggcatttgcggcactgac
ttgcacgaataccttgaaggaccaatcttcgttccgccagcaggacatccgcatcctatt
tccggcgaatccgctcccgtgacgttggggcacgaattctccggcacggtgaccgctctg
ggtgaaggcgtcacggacctgaaggtcggcgagaacgttgtggtggagccctacatcatt
aacgacgacgtagacacttccaagggacagtcgtaccacttgtccaaggacatgaacttt
attggccttggcggccgtggtggcggactctccgagaagattgtggtgaagcgccgctgg
gtccaccctattggcgacatcccacttgatcaggcggctctgattgagccgttgtccgtg
ggccaccacgccttcgttcgttccgaggctaaagctggacaggtcgccattgtgggcggt
gccggccccatcggcttgctcacggctgctgtgctcaaggccgagggactcacggtgtac
atctccgaattgtctgaggcacgaaaggccaaggcccgtgaaaccggcgtcgcggacgac
gtcttcgatccacgcgaagtcaacgtggcggaaaaggttcgcgaactcaccggcggcaag
ggcgctgatgtgggcttcgaatgctcatccgttcccgttgtcttggatatgttgctggac
gctgtgaagccgggcggtgtggtggtcaacgtgtctatctggggtcacaagccagccgtt
gacatgccgaagattgtcctgaaggaaatcgaccttcgcggcactattggttatgcaggg
gatcatccagacaccattgccctggttcagagcggaaagcttgaccttgctccgttcatc
acgggccgcatcggtttggacgaactcgtttccggtggcttcgagcagctcattaacaac
aacgagtatcacgtgaagatcatcgtgaacccaaaggcataa

DBGET integrated database retrieval system