KEGG   Neomicrococcus aestuarii: BHE16_11645Help
Entry
BHE16_11645       CDS       T04559                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
nae  Neomicrococcus aestuarii
Pathway
nae00473  D-Alanine metabolism
nae01100  Metabolic pathways
nae01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BHE16_11645
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BHE16_11645
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nae01011]
    BHE16_11645
Enzymes [BR:nae01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BHE16_11645
Peptidoglycan biosynthesis and degradation proteins [BR:nae01011]
 Precursor biosynthesis
  Racemase
   BHE16_11645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: APF41952
UniProt: A0A1L2ZSK1
LinkDB All DBs
Position
2582915..2584072
Genome map
AA seq 385 aa AA seqDB search
MTAESREGFERVAEIDLSHIRHNVKRLAELAAPAKLMAVVKADAYGHGAVPVAKAALESG
AAWLGTAHVREALALREHGIDVALLAWLHTADTPFEAAIEADIDLGVSGWELPVIAEAAE
KAAKTARIHLKVDTGLGRNGATMERLPSLLVEAQQLQSEGKIRVVGIFSHLAVADEPDRT
ETDDQIQVFREAIALTEAAGFHLEARHIANTPGTLSRPDAHFDLVRCGIGIYGLSPFADQ
SSEDLGLKPAMTLKARVANAKRVPAHQGVSYGLSYQTNEESILVDVPLGYADGIPRSATY
APVMINGNEFRSAGRIAMDQFMMDVGPDQDPEALIGQYAILFGENGPHVDEWAAACNTIN
YEIVTRISGRVPRRYIDGAWGRTDD
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgactgccgaatcccgtgaaggatttgagcgcgtcgctgagattgatctgtcccatatt
cgtcacaatgtgaagcgcttggcggagctggccgctcccgcgaagctcatggccgtggtc
aaagctgatgcgtatggtcacggtgcggtacccgtcgcgaaggctgcgttggaatccggg
gcggcatggttggggacagcacacgttcgtgaggcgctcgcgcttcgcgaacacggaatt
gatgtggccttgctggcgtggctgcacacagcggacacgccatttgaagctgccattgaa
gcggacattgatctcggcgtttccgggtgggaactaccggtgattgctgaggcagcggaa
aaggccgcgaagaccgcgcgcatccacctcaaagtggacaccggattgggccgcaatggc
gccaccatggagcgtcttcccagcctgcttgtggaagcgcaacagctgcagagcgaagga
aagattcgcgtcgtaggcatcttctctcacctcgctgtggcggatgaaccggatcggacg
gaaacggatgaccagattcaggtgttccgcgaagcgattgccctcacggaagctgccggg
ttccatttggaagcccgacacattgcgaataccccgggcacgctgagccgcccggacgct
cactttgatttggtgcgctgcggtatcggaatttacggtctcagccccttcgcggatcag
agctcggaagatctgggcctcaagccagctatgactctcaaagcgcgcgtcgccaacgcc
aaacgagtgcctgctcaccaaggcgtctcttacggcctgagctaccaaaccaacgaggaa
tcaatcctggtggacgtccctctgggatacgccgacggcattccgcgctccgctacctac
gcgcccgtcatgatcaacggcaacgaattccgaagcgctggccgcatcgcgatggaccag
ttcatgatggacgtgggtccggatcaggatcctgaggcgctcattggccagtacgcgatc
ctgtttggggagaacggtccacacgtggatgagtgggcggcggcgtgcaacaccatcaac
tatgagattgtgacgcgcatttcgggccgcgttcctcgtcgctatattgacggagcctgg
ggccgcaccgatgactaa

DBGET integrated database retrieval system