KEGG   Candidatus Nucleicultrix amoebiphila: GQ61_01315Help
Entry
GQ61_01315        CDS       T04833                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
naf  Candidatus Nucleicultrix amoebiphila
Pathway
naf00061  Fatty acid biosynthesis
naf00780  Biotin metabolism
naf01100  Metabolic pathways
naf01212  Fatty acid metabolism
Module
naf_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:naf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GQ61_01315
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    GQ61_01315
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:naf01004]
    GQ61_01315
Enzymes [BR:naf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     GQ61_01315
Lipid biosynthesis proteins [BR:naf01004]
 Fatty acid synthase
  Component type
   GQ61_01315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT EcoRII-C DUF3396
Motif
Other DBs
NCBI-ProteinID: ARN84202
UniProt: A0A1W6N304
LinkDB All DBs
Position
complement(273580..274056)
Genome map
AA seq 158 aa AA seqDB search
MTMTATNLNYESLDIEQIKKLIPHRYPMLMVDRIEKIQSDESAVGIKGVTVNEPFFQGHF
PNYPVMPGVLIVEAMAQTAGVIVSKFLKSEDKEKLVYFMSIDEARFRKPVLPGHVLELHV
TKIQNRRNVWKYKGEAKVDGVLHAEAIFTAMISVSEAK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgactatgactgcaacaaatttgaattatgaaagtttagacatagaacaaattaaaaag
ttgatccctcatcgttatcccatgcttatggtagaccgtattgaaaaaattcaatcagat
gaaagtgccgttggtattaagggagtaacagtgaatgagcctttttttcaaggccatttt
cctaattatcctgtaatgccaggtgtattgattgttgaagctatggcgcaaactgcgggg
gtgattgtaagtaaatttttgaaatctgaagacaaagaaaaattagtttactttatgtct
attgatgaagcacgttttcgtaagcctgttcttccagggcatgtgttagaactgcatgtt
acaaaaatacaaaacagacgtaatgtttggaaatataagggggaggccaaggttgatggt
gttttgcacgcagaagccatctttacagcaatgatttcagtaagtgaggcaaaatga

DBGET integrated database retrieval system