KEGG   Candidatus Nucleicultrix amoebiphila: GQ61_02795Help
Entry
GQ61_02795        CDS       T04833                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
naf  Candidatus Nucleicultrix amoebiphila
Pathway
naf00010  Glycolysis / Gluconeogenesis
naf00020  Citrate cycle (TCA cycle)
naf00620  Pyruvate metabolism
naf01100  Metabolic pathways
naf01110  Biosynthesis of secondary metabolites
naf01120  Microbial metabolism in diverse environments
naf01130  Biosynthesis of antibiotics
naf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:naf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GQ61_02795
   00020 Citrate cycle (TCA cycle)
    GQ61_02795
   00620 Pyruvate metabolism
    GQ61_02795
Enzymes [BR:naf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GQ61_02795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ARN84425
UniProt: A0A1W6N3K4
LinkDB All DBs
Position
complement(561415..562689)
Genome map
AA seq 424 aa AA seqDB search
MPIKILMPALSPTMTEGNLVRWLKKEGDKVSPGDLLAEIETDKATMEVEAVDSGNLAKIY
VAAGSENVKVNDLIAVLLEEGEDASALKNIKIETAKPIAASAPKPTSTPSAPVNQAVAQE
IVQPQRSQHSERVFASPLARRVAEQKGISLNTVQGTGPKGRIVKADVEKSTGKSIPQSKI
SRIPQGPIIASDGMFPAYEEVKLSNMRKVIAQRLTESKQNVPHFYLSVDCEIDALLEARQ
EINEDLEKEARISVNDFIIKACAKALTQVPEANATWGERHIKIFQSADISMAVAIDGGLV
TPIIREAHNKSLFEISTEAKQLIVKARAGKLTPQEFQGGTFSISNLGMYGIKDFSAVINP
PQGCILAVGAGEKRPIVNKNGQIEVGTVMTCTLSVDHRVVDGAVAAEFLQALKKLISTPV
LIFI
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcctataaaaatcctcatgccggcgctttcaccgactatgaccgagggtaacttagtt
cgttggttaaaaaaagagggagataaagtatctcctggagatctactcgccgaaattgaa
acagataaagccacaatggaagttgaagctgttgattctgggaatttggcgaagatatat
gtagctgcaggcagtgagaacgttaaagttaatgatttaattgctgttctgttggaagag
ggtgaagatgcttcagcattaaagaacatcaaaatagagactgcaaaaccaattgctgct
tctgctccgaaaccgacctcaacaccttctgcaccagttaaccaagctgttgctcaagaa
atcgttcaacctcaaagatcacaacattctgaaagagtctttgccagtcctttagcgcgg
cgcgtggctgaacaaaaaggaattagtctgaatactgtgcaaggtactggtcctaaggga
cgaatcgttaaggctgacgtggagaaatctacaggtaaatcgattcctcaatcaaaaatt
tctagaattccgcaaggtcctatcattgcaagtgatggaatgttcccagcttatgaagaa
gtaaaattaagcaatatgcgtaaggtaattgcacagcgtttaacagaatcaaagcaaaat
gtgcctcatttttatctaagtgttgattgtgagatcgacgctttgttggaggcccgccag
gaaatcaatgaggacttagaaaaagaagcccgtatttcagtgaatgactttattatcaaa
gcttgtgctaaagctcttacgcaagttccagaagccaatgcaacttggggtgaaaggcat
atcaaaattttccaaagtgctgatatttctatggctgtagcaatcgatggggggttagtt
acgcccatcattcgtgaagctcacaataaatcactttttgagattagtaccgaagcaaaa
cagctcattgttaaagcaagagcgggtaaacttacgcctcaagaatttcagggtggaact
tttagcatttctaatcttgggatgtatggaattaaggatttctcagcagtgattaaccct
cctcagggttgtattttagctgtaggagctggagaaaaacgtcctattgtgaataaaaat
ggccagattgaagtaggaacagttatgacttgtactttgtctgtcgatcatcgtgttgtg
gatggagcagttgctgcagaatttcttcaagcccttaaaaaattaatttctactccggtg
ttaatctttatttaa

DBGET integrated database retrieval system