KEGG   Candidatus Nucleicultrix amoebiphila: GQ61_08935Help
Entry
GQ61_08935        CDS       T04833                                 

Definition
(GenBank) short-chain dehydrogenase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
naf  Candidatus Nucleicultrix amoebiphila
Pathway
naf00061  Fatty acid biosynthesis
naf00780  Biotin metabolism
naf01100  Metabolic pathways
naf01130  Biosynthesis of antibiotics
naf01212  Fatty acid metabolism
Module
naf_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:naf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GQ61_08935
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    GQ61_08935
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    GQ61_08935
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:naf01004]
    GQ61_08935
Enzymes [BR:naf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     GQ61_08935
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     GQ61_08935
Lipid biosynthesis proteins [BR:naf01004]
 Fatty acid synthase
  Component type
   GQ61_08935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: ARN85391
UniProt: A0A1W6N6G8
LinkDB All DBs
Position
1753834..1754604
Genome map
AA seq 256 aa AA seqDB search
MTGALLRGKKGLVIGIANEHSIAYGCAHVFREMGATLALTYLNSDSYPYVKPLAERLDAP
LLLACDFRIPGQLEAVFEKIKNTWGELDFVLHSVAYAPREDLHARVTDCSKEGFSTAMDL
SCHSFIRIAKQSEPLMKKGGCLLAVSFYGAEKVVKHYNLMGPVKAALESTVRYLAIELAS
QNIRVHALSPGPIKTRAASGLDRFDELMEMVKKRVPNHKLVTIEEVGSLAAFLVSDAAKS
LTGNIEYIDGGYHTLG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgactggggctttattaagagggaaaaaaggattggtcattggtattgccaatgaacat
agcattgcttatggatgtgcacacgtttttcgagagatgggagcgactttggcacttacc
tacttgaatagtgactcttatccttatgtcaagccacttgccgaacgcttagatgccccc
ctgctgttagcctgcgattttcgtattccaggtcaattagaagcagtttttgaaaaaatt
aaaaacacctggggagagcttgattttgtactacattcggtagcctatgcgccgagagaa
gacttgcacgctcgtgtaacagattgcagtaaagaaggtttttcgacggccatggattta
tcttgtcattcatttattcggatagcaaagcagagcgaacctttgatgaaaaaggggggg
tgtcttttggctgtcagtttttatggggctgaaaaagttgttaagcactataatctgatg
ggacccgtcaaggcagccttagagtcgactgttcgttatttagccattgaactggcctct
caaaatattcgtgtacatgctctttcaccaggtcctatcaaaaccagggcagcttcaggt
ttggatcgttttgatgagttgatggagatggtcaaaaagcgcgttcctaatcataaattg
gtgacaattgaagaagttgggagtttagctgcatttttagtgagtgatgctgctaaatct
ttaacgggtaacatcgaatatatcgatggaggttatcacactctcggttaa

DBGET integrated database retrieval system