KEGG   Necator americanus: NECAME_01086Help
Entry
NECAME_01086      CDS       T04867                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nai  Necator americanus
Pathway
nai00010  Glycolysis / Gluconeogenesis
nai00030  Pentose phosphate pathway
nai00051  Fructose and mannose metabolism
nai00052  Galactose metabolism
nai01100  Metabolic pathways
nai01200  Carbon metabolism
nai01230  Biosynthesis of amino acids
nai03018  RNA degradation
Module
nai_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NECAME_01086
   00030 Pentose phosphate pathway
    NECAME_01086
   00051 Fructose and mannose metabolism
    NECAME_01086
   00052 Galactose metabolism
    NECAME_01086
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    NECAME_01086
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nai01009]
    NECAME_01086
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:nai03019]
    NECAME_01086
Enzymes [BR:nai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NECAME_01086
Protein phosphatases and associated proteins [BR:nai01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NECAME_01086
Messenger RNA biogenesis [BR:nai03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     NECAME_01086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 25341130
NCBI-ProteinID: XP_013291203
UniProt: W2SJC4
LinkDB All DBs
Position
Unknown
AA seq 820 aa AA seqDB search
MSEPEKRVHHQEMDGQGEGAGPLPDIPAASLKRNIRRLDSIVPTAGKEGADIQFNLYKGR
GVAVFTSGGDSQGMNSAVRSVVRMGIYLGCKVYFINEGYQGMVDGGDNIVEANWNSVSDI
IQKGGTIIGSARCSDFRKREGRLKAAYNLIEKGITNLVCIGGDGSLTGANQFRKDWPGLI
KELVETKKITPETAANHPNIQIVGLVGSIDNDFCGTDMTIGTDSALQRIIESIDAVVATA
QSHQRSFVVEVMGRHCGYLALVAGLASEADFCFIPEWPPPVNWREILCKKLQEMRAEGQR
LNIIIVAEGAIDRDGTPISAELVKDVVAKTLNYDTRVTVLGHVQRGGAPSAFDRLLGCRM
GAEAVLALMEMNEESEPCVISIDGNQMVRVPLMQCVERTQAVQKAMNAKDWELAVKLRGR
SFQRNLETYKLLTKLRTVEKDNLSGGQNFNVAVMNVGAPAGGMNAAVRSFVRMALYHHCT
VFGVEDSFEGLANGAFKKFQWGDVTNWVMHGGSFLGTQKQLPNEKNVPLIAEQLRKHNIQ
ALLLVGGFEAYHSTLILSKNRDKYPEFCIPMCVIPCTISNNVPGTSISLGSDTAINEICT
MIDKIKQSATGTKRRVFIIETMGGYCGYLATLSALASGADNAYIFEEKFTVEDIIEDVEV
IAAKMAQGVQRYLIVRNEYANKNFTTEFVKQLFAEEGKGEFSTRINILGHAQQGGSPTPF
DRNMGTKLAARALEYIITQIKDSMVNGVVMTKSPETATLLGLTGRRVVFTPVEELASETD
FDKRLPCDQWWLKLRPLLRILAKHTSIYHTEAMEETEDFD
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacctgaaaaacgggtccaccatcaggagatggatgggcagggagaaggtgct
ggtccccttcccgacatccccgccgcaagcctgaaacgaaacatccggaggctcgattct
attgtaccaacggccggaaaagaaggagctgatattcagttcaatctctacaaaggtcgt
ggagttgctgtgttcacatctgggggtgactcgcaaggtatgaacagcgctgtacgatcc
gtggtccgtatgggtatttaccttggctgcaaagtatactttatcaacgaagggtatcag
ggaatggtcgatggtggtgacaacattgtggaggctaattggaattccgtatccgacatt
attcagaaaggaggaacgattattggctcagcacgctgttcggattttcgcaaaagagaa
ggacgattaaaggctgcatataaccttatcgagaaaggtataactaatttggtctgcatc
ggtggtgatggttcccttactggtgcgaaccaattccgaaaggattggcctgggctcatc
aaggagttggtggaaaccaagaagattaccccagaaaccgctgctaatcatcctaacatc
caaattgtcggcctcgttggatccatagacaatgatttttgtggaactgacatgactatt
ggaacggacagcgccttacagcgtattattgagtcaatcgacgctgtagtggccactgct
caaagtcaccagcgttcgtttgtcgttgaggtcatgggtcgccactgcggttacctggcc
ctggtcgctggtctagcctctgaggctgatttctgttttatcccagagtggcctcctcca
gtcaactggcgtgagattctctgcaaaaaactgcaggagatgcgtgctgagggtcaacgt
ctgaacattatcattgttgccgaaggagcaatcgatcgtgatggtaccccaatttcagct
gaactcgttaaagacgtcgtggcaaaaacgttgaattacgataccagggtcactgtatta
ggccatgtccaacgtggtggtgctccgtctgcgtttgatcgccttcttgggtgcagaatg
ggtgccgaagccgtgctagcgctcatggaaatgaacgaggagtctgaaccttgcgtcatt
tccattgatggcaatcaaatggtgcgtgtgcccctgatgcagtgtgtggaacgaactcaa
gcggtgcaaaaggcaatgaatgccaaagattgggaattggcagttaagctgcgaggacgc
agctttcagcggaacctcgaaacatataagttgctgacaaaactgcgcaccgtcgaaaag
gataatctttctggtggacagaacttcaatgtagccgttatgaacgttggagctcctgct
ggaggtatgaatgctgctgttcgctcatttgtgcgtatggctttgtaccatcactgcaca
gtttttggtgttgaggattcatttgagggccttgccaatggagctttcaagaagttccaa
tggggagatgtgaccaactgggtaatgcatggtggctcattcttaggaacacagaagcaa
ctgcctaacgagaagaacgtcccattaattgctgaacagcttagaaagcataatattcaa
gctcttctgcttgttggaggattcgaggcgtatcactcaacccttattttgtcaaagaac
cgtgacaaataccctgaattctgtatacccatgtgtgtaatcccatgcacaatcagtaac
aatgttccaggaacttccatatccctgggttcggatactgctatcaatgaaatttgcact
atgatcgacaagattaagcagtccgccacaggaacaaagagaagggtattcattattgaa
accatgggtggatattgtggttacttagccacactatctgcattggcctctggtgctgat
aacgcttacatttttgaggagaagtttaccgttgaggacattattgaagacgtggaggtt
atcgccgccaaaatggctcaaggagttcagcgatacctcatcgttagaaatgagtacgct
aacaagaacttcacaacagaatttgtaaagcagcttttcgccgaagaagggaaaggagag
ttctcaacgcgtataaatatccttggtcatgcacaacaaggtggcagcccgacaccgttc
gatcgtaacatggggacgaagttggctgcaagagcactcgaatacatcattacacaaata
aaggactccatggtgaacggcgttgttatgactaagtccccagaaacggcaacattactt
ggcctcacaggaagacgcgtcgttttcactcctgttgaagaactagcttctgaaaccgat
ttcgataaacgtttaccgtgcgatcaatggtggctgaaattaagaccactgctgcgtata
ttggccaagcacacttccatctaccacactgaagccatggaagagacggaagactttgat
tag

DBGET integrated database retrieval system