KEGG   Necator americanus: NECAME_06130Help
Entry
NECAME_06130      CDS       T04867                                 

Definition
(RefSeq) SH2 domain protein
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
nai  Necator americanus
Pathway
nai04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:nai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    NECAME_06130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nai01001]
    NECAME_06130
Enzymes [BR:nai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     NECAME_06130
Protein kinases [BR:nai01001]
 Non-receptor tyrosine kinases
  ABL family
   NECAME_06130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 F_actin_bind SH3_1 SH3_2 SH3_9 Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 25346162
NCBI-ProteinID: XP_013308192
UniProt: W2TV38
LinkDB All DBs
Position
Unknown
AA seq 1208 aa AA seqDB search
MKFGVVYTESGCTESADWAESVAAIASVHDSDNMERRPSSVDTFRALHQRESSSWSSRAF
KPEEWDGWVGLFLYMTKIFMPYSNLLSSTDFSEDLLSASMGGGDDATSPLFITLYDFHGV
GEEQLSIRKGDMVRVIGYNKAGEWCEARLAATRQSDLASQKRIGQIGWVPSSYIAPLNSL
DKHSWYHGKVSRSESEYILGSGINGSFLVRESETSIGQYSISVRNDGRVYHYRINVDAND
RLYITQDAKFKTLGELVHHHSVQADGLICNLLFPAPKKERPPCVFSLSPTQPDEWEVERT
EIVMHNKLGGGQYGDVYEGYWKRHERTVAVKTLKEDAMALHDFLAEAAIMKDLHHKNLVQ
LLGVCTREAPFYIITEYMCNGNLLEYLRKSDRSKLPPTVLMYMATQIASAMAYLESRNFI
HRDLAARNCLVGSENVVKVADFGLARFMREDTYTAHAGAKFPIKWTAPEGLAFNTFSTKS
DVWAFGVLLWEIATYGMAPYPGVDLSNVYSLLEKGFRMDSPPGCPPSVYRLMLQCWIWSP
SDRPRFRDIHASLESLFPHSNIDEEVDRQLEKSRLTSQRRSRRSDVVPVSAVRFQDTNNR
RSFSGAGASQRASAEVFPPPPLRSSHHESSLQESAQPSLSSFRDPTADQLRPTPRHLPLP
TPPQSSKPKLLKTALSNASHSMDRGQGNEEVLISPLAEKNIRKAISRFGTLPKTDRIDAY
LESMKRDQPDNSDVGDAESTGMGHALSDDSLDELPIPDPMEGKSQVLVQLKSRLKKTSSE
SPVSPESSQFTSSPPESSAPRSSKLVVTRPAPEPPTRSNAASLPVLPKTDSGKKKVDKVD
GFCQTDSQTTGWKPRRSAKRGPLERVNHIRIKREGKLGDELAEGELKARIRTLRHVEKPD
DKSTSEFAANSADETASTSSASAPEVARVRQLITQKVAPLQHHRPFSVQASSDDSDSSAS
TLAVNMKHVEKRNGGSDSDGPRPFSTLQRPKLREVVSKDRVPSANEELDSGMVRTQSLRD
ITTKFEKLTAAPTKTPISVRGGLVGTAANKRFSLLESKPHSSSVTSETSPSSSPDDVVAT
PLSSCEQQSVSKESLLALYRTLEGCMRDLRNERVGRVTQTSRTDSRLAMLIRLSDVMQQF
HSTCAIYAEQITPHSKFRYRELLNRLEVFVRQLRTCASGSANNPDFAESHILPQFEVTFR
QILQLINR
NT seq 3627 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcggtgtcgtttacactgagtcgggatgtactgaatcagctgactgggctgaa
tcggtagccgctatagcgagcgttcacgatagtgataacatggaacgccgtccatcatcc
gttgatacatttcgtgcattgcatcagcgtgaaagctcatcgtggagtagtcgggctttt
aagccagaagagtgggatggatgggtcggactgtttctttatatgactaaaattttcatg
ccctattctaatctcttatcatccacggatttcagtgaggatttgctgtccgcatcgatg
ggtggaggtgacgatgcgacttcgcctttattcatcacactttatgattttcatggtgtt
ggtgaagagcagctttcaatacgaaaaggtgacatggttcgggtgattggttacaacaag
gcaggagaatggtgtgaagcacgtcttgcggctactcgacaatccgatttagcaagtcaa
aagcgaattggacaaattggctgggtgccaagtagctatatcgctcctctcaactcactt
gataaacatagttggtatcatgggaaggtgtcgcgcagcgaatcggagtatattttgggt
agcgggatcaacgggtcatttcttgttcgtgaatcggagaccagcatcggacaatattcg
atttctgttcgaaatgatggtcgagtttaccactataggattaacgtggacgcgaatgat
aggctatacatcacacaagatgcaaaatttaaaactttgggtgaattagttcatcatcat
agtgtccaggcagatggtctgatttgtaatctgttatttcctgctcctaaaaaggagaga
cctccatgtgttttctcgttaagtccaactcaaccagacgaatgggaggtggaacgtacg
gaaattgtcatgcacaataaattaggcggcggtcagtatggcgatgtttacgaaggatac
tggaaacgccatgaacgaactgttgctgtgaaaactttgaaggaagatgcaatggcttta
catgatttcctagccgaagctgctataatgaaagatcttcatcacaagaatcttgtacag
ttactaggggtttgcacacgagaagcacctttctacataatcaccgagtatatgtgtaac
gggaatttgttagaatatctaagaaaatcggaccgatcgaagttaccaccgacggtgttg
atgtatatggctactcagatcgcatcagcaatggcttatttggagtcgaggaactttatt
catagagatctcgcagctcggaattgtcttgttggcagcgaaaatgttgtaaaagtagca
gattttggcttggcacgttttatgagagaagatacgtacacagctcacgcgggtgcaaaa
ttcccgatcaaatggacagctcctgaagggctcgccttcaatacattcagtacaaaaagc
gatgtttgggccttcggagtcttgctttgggaaattgcaacgtatggtatggcaccatat
cccggagtggacttatcgaatgtttattctttgctcgaaaagggattccgcatggattcg
ccgcctggatgcccacctagtgtctatcgtctgatgctacagtgctggatttggtctcct
agcgatcgaccgcgatttcgtgatatacatgcgagtttagaatcactgttcccacattcc
aacattgatgaagaggtggatcgccaattggaaaaatcccgtctcacttcccaacgtcgc
tcccgtcgcagcgatgtcgttcccgtatcagcggtacgattccaagacacaaataatcga
cgctccttcagtggagctggcgcttctcaaagagcttccgcagaagtatttccaccacct
ccgctgcgatcttcgcatcatgagtcatcgctacaggaatcagctcaaccatctctttca
tcgttccgcgatccgactgctgatcagcttcgaccaactccacgtcatctaccgcttcca
actcctccacaatcctctaagcccaagttgctgaagacagcactgagcaacgcatctcat
tcaatggatcgcggacaaggcaatgaagaggtccttatttcaccacttgcggagaagaat
atccggaaggccataagtcgttttggaacgctgccaaaaactgatcgaatagatgcatat
ttggaatcgatgaagagggatcaaccagacaactcggatgttggtgacgcggaatctaca
ggaatgggccatgccctctctgatgattctttggatgagcttcctattcctgatcctatg
gagggcaagagccaggtgctagtacagttgaagtcccgcctaaagaaaacttcatcggag
tcaccagtttctccggaatctagccagtttacgagtagtccacctgagtcttctgcgcca
cgatcgagtaaacttgttgtcactcgtccagctccagaacctcctactcgctccaacgcg
gcatctttaccagtccttcctaagacggatagtggcaagaagaaagtggacaaggtggat
ggattttgtcaaacggattcgcaaaccaccggttggaagcctagacggtcagcaaagcgc
ggtcctcttgaaagggtgaatcatattcgaattaagcgcgaagggaaactcggcgatgaa
ctggcagaaggtgaactaaaggccaggattcgaacgttacgtcatgttgaaaaaccagat
gataagagcacgtctgaatttgctgcaaactcagccgatgaaactgcctctacgtcatca
gcatccgcgcccgaagtagctcgagttagacagcttatcactcagaaggttgcaccgcta
cagcatcatcggcccttctctgtgcaggcctcctctgatgattcggactcgtccgcatcc
accctagcagtgaatatgaagcatgtagaaaaacgaaacggtggctcggactctgacgga
cctcgcccattcagcacactccaaagaccgaagctcagagaagtagtatcgaaagatcgt
gttccttccgctaacgaagagctcgattcgggcatggttcgcactcaatcgttgagagac
atcacgacgaaatttgagaaactcacagcggctccgactaaaactccaatctcagttcgc
ggtggacttgttgggacagctgcgaacaaacgcttttctcttctggaatctaagccacat
tcctcatctgttacatcagagacgagtcccagtagtagtccggacgatgtggttgctaca
ccgctgtctagttgtgaacagcaaagtgtaagtaaggaatcactactggccttatatcgc
actctcgaaggatgtatgcgtgatcttcgcaacgaaagagtcggacgcgtaacgcagaca
tctcgtactgactctcgacttgcgatgctgatccgacttagcgacgtcatgcaacaattt
cactcaacctgtgccatctacgctgaacaaatcactccgcatagtaaattccgatatcgt
gagctattaaatcgtctggaagtgtttgtacgccagttacgtacatgcgcatccggatcg
gcaaataatccagactttgctgaatcacatatccttcctcaattcgaggtcacttttcgt
caaatactacaactaatcaaccgttga

DBGET integrated database retrieval system