KEGG   Necator americanus: NECAME_08390Help
Entry
NECAME_08390      CDS       T04867                                 

Definition
(RefSeq) succinate dehydrogenase, flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
nai  Necator americanus
Pathway
nai00020  Citrate cycle (TCA cycle)
nai00190  Oxidative phosphorylation
nai01100  Metabolic pathways
nai01200  Carbon metabolism
Module
nai_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nai_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nai_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:nai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NECAME_08390
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NECAME_08390
Enzymes [BR:nai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NECAME_08390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Ank_2 Ank_4 Ank_5 Ank Ank_3 GIDA Thi4 Pyr_redox_2 DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 25348420
NCBI-ProteinID: XP_013303819
UniProt: W2TKP7
LinkDB All DBs
Position
Unknown
AA seq 897 aa AA seqDB search
MLSVARRSVGSLLSRRTYALAASTTDAKHGNIANYKVVDHAYDAVVVGAGGAGLRAAMGL
SEGGLKTAVITKIFPTRSHTVAAQGGINAAIGSMNKDDWRWHFYDTVKGSDWLGDQDAIH
YMCREACRAVIELENYGMPFSRTADGKIYQRAFGGQSNDFGRGGQAHRTCAVADRTGHSL
LHTLYGASLQYNCNYFVEYFALDLIMDKGVCVGVVALCMEDGTIHRFRSKNTVLATGGFG
RAYFSCTSAHTCTGDGTALVARAGISNTDMEFVQFHPTGIYGAGCLITEGSRGEGGYLVN
SKGERFMERYAPNAKDLASRDVVSRAMTVEVMEGRGVGPEKDHIFLQLHHLPAKQLHERL
PGISETAMIFADVDVTKEPIPVIPTVHYCMGGVPTNYKGQVISYSKEKGDQIIPGLYAAG
ECSAQSVHGANRLGANSLLDLVIFGRAAALSILEHTKPGVGVPDLPKDAGESSVDNIDSL
MNRKDGPSTADVRLQLQKTMQKHAAVFRRGDILQARDAALPSNTNFSYYFQEGVKKVGEI
YKNIDNLHVSDKSLIWNSDLVETLELQNLLINAIQTIVAAEARKESRGAHARDDFPTRID
EYDYGKPLDGQKKKPIEEHWRKHTMITSDIKTGKVKLDYQATARAVEACQRGSMEALEAA
LQEGVPPNATDADGCSLLHWAAINNRLEIIMRLLDLGADPNVVGGLLVSSPLHWAARVGH
SNSAALLVKAGAVANVRDTQGYAPIHLAVQTNQSTLVAYLLEKFDYCKDITDNSGMTPVM
WAAYRTFGMFPIRLLVRSGANLNAQEHLSGNTALHIAAQERNYCSIRELLAGNADPLLRN
KQQETPMDIARNMRNHKIIGMLEEAMSTRGVSAVKCTACDNIPWKKVNRSAGLFIPG
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgttatcggtggcaaggcgcagtgtcggaagcctgctgtcacgtcgtacttatgcgctc
gctgcctccacaaccgacgctaaacatggaaatatcgccaactataaagttgtcgatcac
gcttacgatgctgtcgtcgttggtgcaggaggcgcaggcctacgtgctgcgatgggattg
tcggaaggtggtctaaaaacggctgtcatcacgaagatcttccccacccgatcgcatact
gttgctgcacaaggtggtattaatgcagccataggaagtatgaacaaggacgactggcgt
tggcatttctatgacactgttaagggatctgactggcttggagatcaagatgccattcac
tacatgtgtcgagaagcctgccgagccgtaattgaattggagaactacggtatgcctttc
tcccgtaccgccgatggaaagatttaccagcgtgctttcggaggacagtccaacgatttc
ggtcgtggtggacaagctcatagaacttgcgccgttgcggatcgtactggacactcactt
cttcacaccctttatggagcttcgttgcagtacaactgcaattactttgtggagtatttc
gcccttgatctcatcatggacaagggtgtatgcgttggtgttgttgcattgtgtatggaa
gatggaacaattcatcgattccgttcaaagaacacggtgttggcaacaggaggattcggg
cgagcgtacttctcatgcacttctgcgcacacttgcactggagatggaacagctttggtt
gctcgtgcaggtatcagcaacactgacatggaatttgtccagttccatcctaccggtatt
tatggtgcaggatgtttgatcactgaaggatctcgaggagagggcgggtatcttgtgaat
tccaaaggagaacggttcatggaacgatatgcgccaaatgctaaagatttggcttcccgt
gatgtcgtatctcgtgcgatgaccgtggaagtgatggagggacgtggtgttggtccagaa
aaggaccacattttcttacaacttcatcatctgcctgctaaacagctccatgagagatta
cctggtatctcagaaactgccatgatttttgctgatgttgatgttactaaggaaccaatt
cctgtcattcctactgtacattattgcatgggtggtgtcccaaccaactacaaaggacag
gtcatcagttattctaaggaaaaaggtgaccagattattcccggactgtacgcggcgggt
gaatgctccgcacagtcggtgcatggtgcaaatcgattgggtgcgaactcattgcttgac
ttggtcattttcggaagagccgctgctttgagcattctcgaacatactaagcctggtgtc
ggtgttccggatctgccaaaggatgctggagagtcatctgttgataatatcgattcccta
atgaataggaaggatggtccatctactgctgatgtgcgacttcaattgcagaagaccatg
caaaaacacgctgctgtgttcaggcgtggagatatcttgcaggcaagagatgctgctctg
ccgagcaacacaaatttctcctattatttccaggagggcgttaaaaaagtgggagaaatc
tataagaatatcgacaatttgcacgtgtcggacaagagtttgatttggaatagcgatctg
gttgagacacttgagctccagaatcttctcatcaatgccattcaaaccattgttgcagcc
gaggctaggaaggaatcacgtggtgctcatgctcgtgatgatttccccactcgtatcgac
gaatacgactatggaaaaccgctcgacggccagaagaagaagccaatcgaggaacactgg
cgcaaacacacaatgattacctctgacataaaaaccggcaaagtgaaactcgactatcaa
gccactgctcgtgcagtggaggcttgtcagcgaggtagtatggaagcgttggaagcggca
ctgcaggaaggtgtaccaccaaatgcaacagacgctgatggatgctctttattacattgg
gctgccataaacaaccgcttagagatcataatgagactgcttgatttgggagcggatcct
aacgtcgtcggtggactactggtttcatctccactccactgggccgcacgtgtcggacat
agcaacagtgctgcactacttgtgaaggctggcgctgtagcaaatgtacgtgacactcaa
ggctacgctccaattcatttggcggtacaaaccaaccagtcaacacttgttgcatattta
ttggagaaatttgactactgcaaagatattacggataatagtggaatgacaccggttatg
tgggcagcatatcgtacgtttggaatgttcccaatacgtcttctagtaagatctggagcg
aatttaaacgctcaagagcatctatccggtaacaccgctcttcatatcgcagcgcaggaa
aggaactattgttccatcagagagttattggcagggaatgcagatcctctccttcgtaat
aagcagcaggagactcccatggatattgcaagaaatatgaggaatcataagattattggt
atgctcgaggaagcaatgtcgacgcgtggtgttagtgctgttaagtgcactgcttgcgac
aacatcccgtggaagaaagtcaatcgctctgcaggattatttattccgggctag

DBGET integrated database retrieval system