KEGG   Necator americanus: NECAME_09527
Entry
NECAME_09527      CDS       T04867                                 

Definition
(RefSeq) phorbol esters/diacylglycerol binding domain protein
  KO
K09850  Ras association domain-containing protein 1
Organism
nai  Necator americanus
Pathway
nai04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:nai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04392 Hippo signaling pathway - multiple species
    NECAME_09527
SSDB
Motif
Pfam: RA C1_1 Nore1-SARAH Ras_bdg_2 MNR
Other DBs
NCBI-GeneID: 25349556
NCBI-ProteinID: XP_013302144
UniProt: W2TFY2
LinkDB
Position
Unknown
AA seq 512 aa
MPEWDDEHWDFGASFLADLDSSHVWNDTLERQHFGPLKDLVTTGGTRADGHNFVSITLMH
PTWCDKCGDFIWGLLKRASKCEKCNYTCHSRCRELVTLECRSAGSSLSSGEFPSIYPKLL
DGTLGTIPKDLHLPPIPLHSPFGDSDKENDTSAENPLFSPSKAPRPGPLSALGHPINDNV
QPEVVNGQTLQISEVYVKEDTPFEWSPAYRDEHLAERIEDYNRTSDGLCMKMSDDGETFS
GHIQIHMNLTRPISVVAGEKPPTVYDVVNTGKSTMSSLRTITSFFLPRNTVKTININSTM
TTRQMIVTLLRKFRVADNPRKFALYECSYESDEETPTLLSKSWKMTRISDDVCPLKVVLS
WQNAKCGKALVLQENDTGDILWDAFEVPELDNFLRILRMEEQQYQWQIRQRYHQYRFYVD
MELRRRGYGLGEDLGEPPTMSAPPPPPLADYNEYGTGDSMIVSDVFHTIREDQLLPSTLR
SKEESPAGEVHDPTYVNLSFLRAQQMEQSTRL
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgcctgagtgggacgatgagcactgggactttggcgcatcattcttagccgatttggat
tcttcccacgtttggaatgacaccttagaaagacaacacttcggacctttaaaggatcta
gtcacgacaggaggcacgagggccgatggtcataattttgtgtcgatcactttgatgcat
cctacatggtgcgataaatgcggtgacttcatttggggtcttctgaaacgtgcatccaag
tgcgaaaagtgtaactacacttgccatagtcgatgcagagagctcgtgacgttggagtgt
cgatcagccggctcttcgctctcatccggagagttcccctcgatttatcctaagctctta
gatggcacattaggtaccatacctaaggatttgcatttgccaccaatacccttacattca
ccgtttggtgactctgataaggagaacgacaccagcgctgagaaccctctcttttcgccc
tcaaaagcgccccgtccagggccactgtctgcactgggccatccaataaatgataatgtg
caacctgaagttgtaaacggacagactttgcaaatatcagaagtttacgtaaaggaagac
acacctttcgaatggtcaccggcctacagggacgaacacctcgcagaacgtatagaagac
tataatagaactagcgacggtttatgtatgaagatgagtgatgacggcgaaacattttct
ggacatatccaaatccatatgaatttaactcgaccgatcagtgtcgttgctggcgaaaaa
ccgccaacggtgtacgatgttgtgaatactggaaaatcaacgatgtcgtcactacggacc
atcacatcatttttcttgccgaggaacacggtgaagacgatcaacatcaacagcacaatg
acaacaaggcagatgattgtcactttgctgcgcaaatttcgagtagctgataatccaagg
aaattcgctttgtatgaatgcagttacgagagcgacgaagagactccgacattacttagt
aagtcttggaaaatgactcgaatatcggacgatgtttgtcccctgaaggttgttctcagc
tggcaaaacgctaaatgtgggaaagcactggtcctgcaggaaaatgacaccggagacatt
ttgtgggatgcattcgaagttcctgagctggataattttcttaggatcctacgaatggaa
gaacaacaatatcaatggcaaatacggcaacgatatcatcagtacaggttttacgtggac
atggaacttcgacgccgtggatacggtctgggcgaagacctcggggagccgccaaccatg
tcagctccgccacctcctccgttggccgactacaacgagtacggaactggtgacagcatg
atagtcagtgatgttttccacacaatccgtgaggaccagctgttaccgtcaacgctccgg
tctaaagaggaatctcctgctggggaggtgcacgaccccacatatgtgaatttaagcttc
cttagagcgcagcagatggaacagtcgacgaggttatga

DBGET integrated database retrieval system