KEGG   Necator americanus: NECAME_11252Help
Entry
NECAME_11252      CDS       T04867                                 

Definition
(RefSeq) copper/zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
nai  Necator americanus
Pathway
nai04146  Peroxisome
nai04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:nai00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    NECAME_11252
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    NECAME_11252
Enzymes [BR:nai01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NECAME_11252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 25351281
NCBI-ProteinID: XP_013299343
UniProt: W2T7H1
LinkDB All DBs
Position
Unknown
AA seq 180 aa AA seqDB search
MFIYAVSEALKNFFQVDASQRMSNRAVAVLRGDAGVTGTVWFSQDKESDPCVIKGEIKGL
TPGLHGFHVHQYGDSTNGCISAGPHFNPFNKTHGGPKDEVRHVGDLGNVEAGSDGVARFE
IKDNMVKIHGEHTVVGRSLVVHAGTDDLGKGVGEKQEESLKTGNAGARSACGVIAIAAPQ
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgttcatctatgcagtttcggaagcgttgaagaatttcttccaggttgacgcttctcaa
agaatgagcaatcgagcagtagctgtcctacgaggtgatgcaggagtaaccggaacggtt
tggttcagtcaggacaaagaatccgacccttgtgttatcaagggtgagatcaagggccta
actcctggcctccatggtttccacgttcaccagtacggagactcaacgaatggatgcata
tcggctggacctcacttcaacccattcaacaagacacatggtggaccgaaggacgaggtc
cgccatgtcggtgatcttggcaacgttgaagctggttcggacggtgtcgcccgtttcgag
atcaaggataacatggtgaagatccacggcgagcacacagttgttggacgttcgctcgta
gttcacgctggtacagatgaccttggcaaaggagtaggtgagaagcaggaggaatctttg
aagactggaaacgcaggagctcgatctgcgtgtggagttatcgcaattgccgctccacag
tga

DBGET integrated database retrieval system