KEGG   Natrialbaceae archaeon JW/NM-HA 15: B1756_12430Help
Entry
B1756_12430       CDS       T04999                                 

Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
naj  Natrialbaceae archaeon JW/NM-HA 15
Pathway
naj00564  Glycerophospholipid metabolism
naj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:naj00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    B1756_12430
Enzymes [BR:naj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     B1756_12430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_3 Pyr_redox_2 FAD_binding_2 Pyr_redox NAD_binding_8 Thi4 3HCDH_N Pyr_redox_3 Lycopene_cycl FAD_oxidored YbjQ_1 ApbA HI0933_like GIDA
Motif
Other DBs
NCBI-ProteinID: ARS90455
LinkDB All DBs
Position
2542917..2544698
Genome map
AA seq 593 aa AA seqDB search
MPSDTDVLVLGGGSTGCGIARDLAMRGLEVTLLERGTLTDGTTGRMHGLLHSGGRYAVSD
RASARECIEENRVLREIAGHCVEETGGLFVKRPEDPDEYFEEKLEGCRDCGIPARVLSGR
EARANEPYLAADVERAIEVPDGAVDPFRLCVANAIDAENHGARIETHAEVVDLLCDGDDV
TGAVVRHGAGPGKRTDVAAGSLEEITAEYVVNATGAWAGQIGAMADLEIAVRPSKGVMTI
MNVRQVDTVINRCRPKGDADIVVPHETTAILGTTDVEVEDPDDYPEERWEVDLMIDSLAE
LVPILREARTIRSFWGVRPLYEPPGTGTVDPTDITRDFFLLDHADRDEVAGISSIVGGKF
TTYRAMAEDIADHVCDKLGVRASCATAEEPLPGSENLETLAAGMDDFGLRSPIARRSKQR
LGSRSQAVLECSDPNPVICQCEGVTRAEIRDAIEQSGADLNAVRIRTRASMGNCQGGFCC
QAMATELHPDHDADTVRAALSELVAERWKGERHACWGEQLSQAMVNYALYATTANLDADP
ASDAGTDPGDGSDSLPYAAFDRGPDREPEGAAPRAGTDRPDTRGAGTDAGGGR
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgccatcggacaccgacgtgctcgtcctcggtggcggctcgaccggctgtggcatcgcc
cgggacctggcgatgcgcggcctcgaggtcaccctgctcgagcgcgggacgctgacggac
ggaaccacgggtcgcatgcacggactcctccacagcggcggccgctacgcggtctctgac
cgggcgagcgcccgcgagtgcatcgaggagaaccgggtgctgcgagagatcgcgggccac
tgcgtcgaggagactggcgggctgttcgtcaagcgccccgaggatcccgacgagtacttc
gaggagaaactcgagggctgtcgcgactgcgggattccggcgcgcgtgctctccgggcgc
gaggcccgcgcgaacgaaccctacctggccgctgacgtcgagcgcgcgatcgaggtgccc
gacggcgcggtcgacccgttccgcctctgtgtcgcgaacgcgatcgacgccgagaaccac
ggcgcgcgcatcgagacccacgccgaggtggtcgacctgctgtgcgacggcgacgacgtc
accggtgccgtagtccgccacggcgcaggccccggtaaacggaccgacgtggccgcgggg
agcctcgaggagatcaccgccgagtacgtcgtcaacgcgacgggcgcgtgggccggccag
atcggggcgatggccgacctcgagatcgccgtccgcccgtcgaagggtgtaatgaccatc
atgaacgtccggcaggtcgacaccgtgatcaaccgctgccggccgaaaggcgacgcagac
atcgtggttccccacgagacgaccgccatcctcggcaccacggacgtcgaagtcgaggac
ccagacgactaccccgaggagcgctgggaggtcgacctgatgatcgacagcctcgccgaa
ctcgtgccgatcctccgggaggcccggacgatccgctcgttctggggcgttcgcccgctg
tacgaaccgccggggaccggaaccgtcgatccgaccgacatcacgcgggacttcttcctg
ctcgatcacgcagaccgcgacgaggtagctggaatctcgagcatcgtcggggggaagttc
accacctaccgcgcgatggcggaggatatcgcagaccacgtctgcgacaaactcggcgtc
cgggcctcgtgtgcgaccgccgaggaacctctgcccgggagcgagaacctcgagacgctc
gcggccggcatggacgacttcgggttgcgctcgccgatcgctcgccggtcgaaacagcgt
ctgggaagtcgcagtcaggcggtactcgagtgctcggacccgaacccggtgatctgccag
tgcgagggcgtcacgcgagcggagatccgtgacgcaatcgagcagtccggcgcggacctg
aacgccgttcgcatccggacccgggcctcgatgggcaactgccagggtggcttttgctgt
caggcgatggcgaccgaactccatcccgaccacgacgccgacaccgtccgcgcggccctg
tcggaactcgttgccgagcgctggaagggcgaacgccacgcctgctggggcgaacagctc
tcccaggcgatggtcaactacgcgctgtacgcgacgacggcgaatctggacgccgacccg
gcgagcgacgccgggacggatccgggggatggctcggactcgctcccctacgcagcgttc
gaccgcggtccggatcgcgaacccgagggagcggctcctcgagcggggaccgaccgcccc
gacactcgaggtgccggaaccgacgccggaggtggccgctga

DBGET integrated database retrieval system