KEGG   Natrialbaceae archaeon JW/NM-HA 15: B1756_14315Help
Entry
B1756_14315       CDS       T04999                                 

Definition
(GenBank) type III ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
naj  Natrialbaceae archaeon JW/NM-HA 15
Pathway
naj00630  Glyoxylate and dicarboxylate metabolism
naj01100  Metabolic pathways
naj01120  Microbial metabolism in diverse environments
naj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:naj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    B1756_14315
Enzymes [BR:naj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     B1756_14315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ARS90778
LinkDB All DBs
Position
2930132..2931382
Genome map
AA seq 416 aa AA seqDB search
MTGIEYDDFLDLAYEPAASDLVCDFRLEPAEGMSMEAAASRVASESSNGTWAALHVDEDE
LTHLGAVACDIDGDRVTVAYPEELFEPGSMPQILSCIAGNIMGMKAVDTIRLLDCHWPEG
LAQSFPGPQFGTSVAHEKLDAGDRPVLATVPKPKVGLSTEAHVRVGEEAWRGGIDLLKDD
ENLTDQEFNPFEDRLAESLAARDRVQEDVGERKDYLVNVTGETTEMLERVDLVADHGGGF
VMVDVITCGWSAVQSVRQRCDDHGLAIHAHRAMHAAFDRLPHHGVSMRVLAQIARLTGVD
HIHTGTAGLGKLANEDTPGINEWLTGDLYGLEPVLPVASGGLHPGVVDQLLEALGTDIIV
QAGGGIHGHPDGTHAGAKALRQAIDASVEGVALEEYAAEHAELETALEKWGAETPR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgactggaatcgagtacgacgactttctggacctcgcgtacgaaccggcggcgtcggac
ctcgtctgtgactttcggctcgaaccggccgaggggatgtcgatggaggcggcggcgagt
cgggtcgcctcggagtcttcgaacggcacgtgggcagcccttcacgtcgacgaggacgag
ttaacgcatctcggcgcggttgcttgcgacatagatggcgaccgggtcaccgtcgcctac
cccgaagaactgttcgagcccggaagcatgccccagatcctctcgtgtatcgccgggaac
atcatggggatgaaagccgtcgacacgatccgactgctcgactgccactggcccgagggg
ctcgcccagagctttccgggtccccagttcgggaccagtgtcgcccacgaaaagctcgac
gccggcgaccggccggtgctggcgacggttcccaagcccaaggtcggactctcgaccgag
gcccacgtccgcgtcggcgaggaggcctggcgcggcggcatcgacctcctcaaagacgac
gagaacctcaccgaccaggagttcaaccccttcgaggaccgcctcgccgagagtctggcc
gcccgcgaccgcgtccaggaagacgtcggcgaacgcaaggactacctcgtgaacgtcacc
ggtgagaccaccgagatgctcgagcgcgtcgacctcgtggccgaccacggcggcgggttc
gtcatggtcgacgtcatcacctgcggctggtcggccgtccagagcgtccgccagcgctgt
gacgaccacgggctggcgatccacgcccaccgtgccatgcacgccgccttcgaccgcctt
ccccaccacggcgtctcgatgcgcgtgctcgcacagatcgcccgcctcaccggcgtcgac
cacatccacactggcaccgcgggactgggcaaactcgcgaacgaggacacaccggggatc
aacgagtggctcaccggcgatctgtacggcctcgagccggtgctccccgtcgcctccggc
ggactccaccccggcgtcgtcgaccagttactcgaggcgctcgggaccgacatcatcgtc
caggccggcggcggcatccacggccacccggacgggactcacgccggtgcgaaagcactt
cggcaggccatcgacgcctcggttgagggagtcgccctcgaggagtacgcagcagaacac
gcggagctggagacggccctcgagaagtggggcgcggagacgccacggtaa

DBGET integrated database retrieval system