KEGG   Natronolimnobius aegyptiacus: B1756_18515
Entry
B1756_18515       CDS       T04999                                 

Definition
(GenBank) hypothetical protein
Organism
naj  Natronolimnobius aegyptiacus
SSDB
Motif
Pfam: DUF4013
Other DBs
NCBI-ProteinID: ARS91518
UniProt: A0A2Z2I309
LinkDB
Position
3836687..3838036
AA seq 449 aa
MDAVDNLGDAIDVTRDLLLPIRPWFWLKLAIVVFFVAGLGFGGGMPTDPTFVSEFEDPAV
EEPTPEEPFPADPAVEDPAEPELAEEDVLLILLVVVGFFLLFIALWFLYALLGGIAEFVF
IESLRTQEVSIRQYTRRHFWRGVRLFGFRLGVGIIAAILVGVPTILLFFLVGATDGGLIA
LIGVAFLLSIAVTFVQAIVNRFTSEFVAPIMLLESRGVLSGWRRFWPTFRTNWKEYVVYL
LLVWVLQLVINIAAVFVIGFGLVLLAIPVFVLVLLLTLLGGIGLILAIPIVLLAALLALL
IVAVVQMPIRTYFQYYALLLLGDTNADLDLIPEQRAAVRSGDGRGPGPAGGAGGPGGPGG
AGGAGRTGDTTDTDPDVDTENGWDSQRDERADDRESRGAEDGDSFWDDRTDSLADSDADT
ADRDVWEREETDDEDDEDDERDEDDGRGW
NT seq 1350 nt   +upstreamnt  +downstreamnt
atggacgcagtcgacaacctcggcgacgcgatcgacgtcacgagggacctcctccttccg
attcgaccgtggttctggctcaaactcgccatcgtcgtgttcttcgtcgccggactcggc
ttcggtggcggcatgccgaccgatcctaccttcgtctccgagttcgaggaccccgcggtg
gaagagcccacgcccgaagaaccgttccccgccgatccggcggtcgaagaccctgctgaa
cccgaactcgccgaagaggacgtcctgctgatcctgctcgtagtcgtcggcttcttcctc
ctgttcatcgcgctgtggttcctctacgcgctgctgggcggcatcgccgagttcgtcttc
atcgagtcgctacgcacccaggaagtgtcgatccgacagtacaccagacgacacttctgg
cgcggcgttcgtctcttcgggtttcgactcggggtcggcatcatcgctgccatcctcgtc
ggcgtcccgacgattctcctgttcttcctcgtcggagcgacagacggtggactgatcgcg
ctcatcggggtcgcgttcttgctctctattgctgtcaccttcgtccaggccatcgtcaac
cgcttcacctccgaattcgtcgcccccatcatgctgctcgagtcccggggggttctgagc
gggtggcgtcgcttctggccgacgttccggacgaactggaaggagtacgtcgtctacctg
ctgctggtgtgggtgctccagctcgtgatcaacatcgccgccgtcttcgtgatcggcttc
gggctggtcctgcttgcgatccccgtcttcgtgctggtcttgctgttgacgctcctcggg
ggcatcgggctcatcctcgcgattccgatcgtcctgctcgctgccttgctcgcgctgttg
atcgtcgcggtcgtccagatgccgatccggacgtacttccagtactacgcgctgttgctc
ctcggcgacacgaacgccgacctcgatctgatccccgagcagcgtgcagccgtgcggtcg
ggcgatggtcgtggtcccggtcccgccggtggcgcaggtggaccgggcggtccaggcggt
gctggcggtgctggccggaccggtgacacgacggacaccgacccagacgtcgacacggag
aacggttgggacagccagcgagacgaacgtgccgacgaccgtgagagtcgtggggctgag
gacggcgattcgttctgggacgaccgcacggactccttggctgactcagacgcggacacc
gccgaccgggacgtctgggagcgtgaggagaccgacgacgaagacgacgaagacgacgaa
cgggacgaagacgacggtcgcggctggtag

DBGET integrated database retrieval system