KEGG   Nakamurella sp. s14-144: EH165_00205Help
Entry
EH165_00205       CDS       T05729                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
nak  Nakamurella sp. s14-144
Pathway
nak00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:nak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    EH165_00205
Enzymes [BR:nak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     EH165_00205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_2_C Glyco_hydro_35 Glyco_hydro_14 Cellulase
Motif
Other DBs
NCBI-ProteinID: AZI56825
UniProt: A0A3G8ZJ07
LinkDB All DBs
Position
complement(37570..39564)
Genome map
AA seq 664 aa AA seqDB search
MNTVTGHIGGLAYGGDYNPEQWDREVWLEDVALMREAGVNLVTVGVFSWALLEPSAGVYQ
FDWLDEIVDLLHANGIAVDLATSTASPPPWFTINNPQARLVDAFGSVRVHGGRQAFCPSS
PEYRAASVAMASEMVRRYAGHPAVVMWHINNEYGCQNFECFCPQSAASFRVWLGAKYGTL
EELNRCWGTNFWSQRYGQWDQILPPSAVSYNSFINPTQQLDWKRFTSSEFEACYLGEAAE
LRAHARQPVTTNFMSFFEHVDYFAFAEHVDIVSNDDYLLSENVNSTHYTAMTADLMRSLA
KGKPWLLMEHSTSAVNWQNRNQAKGPGEMRRNSLQHIARGSDGALFFQWRASKAGAEKYH
SALLPHAGTNSTRWREVVEFGANLKALAAVAGSTVAPASTAILYDWNSVWALNQKAHPSV
DYSVMDQVQRWHHEMYRRNVGVDFLGPGADLAGYKLLLIPGLYLVDQATSDAVAEFVRGG
GTVLVSYFSGTVDENDHIWLGGYPGAFREVLGVTVEEFSPLPVDGAIELTEFGSGTIWSE
TARADSAEVLAQYVGGNVTGSVALTCNSFGAGKAYYVGTELGDTGRGELFDRVLGTAGIV
SAEVADGVEVVVRRGETASWTFVINHSDAAAKVSLPGRDLLGDGSIHDSFVVPAGGVSVL
ENPA
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacggttaccggtcacattggcggcttggcctacggcggcgattacaaccccgag
cagtgggaccgggaggtgtggctcgaagacgtcgcattgatgcgcgaagccggagtcaac
ctggtcaccgtcggagtgttctcgtgggcattgctcgagccgagcgccggcgtataccag
ttcgactggcttgacgagattgtagatctgttgcacgccaatggcattgccgtcgatctc
gcgaccagcacggcttcgccgccgccgtggttcaccatcaacaatccgcaggcacgtctt
gtcgatgccttcgggtctgtccgggtacacggcggcaggcaggcattctgcccgtcgtca
ccggagtatcgagcggcgagcgtagcgatggcctccgagatggtccgccggtacgcgggc
catcccgccgtcgtcatgtggcacatcaataacgaatacggctgccaaaacttcgaatgc
ttctgcccgcagtcggcggcgtcgttccgggtctggctgggggcaaagtacggcaccctg
gaggagctcaaccgctgctgggggacaaacttctggagccaacgctacggccagtgggac
cagatcctgccaccgagcgcagtctcgtacaactcgttcatcaacccgacccagcaactg
gactggaagcgtttcacctcaagcgaattcgaggcgtgctacctcggcgaggccgctgag
ctgcgagcccatgcgcggcagcctgtcaccacgaacttcatgtcgttctttgagcacgtc
gactactttgctttcgccgagcacgtcgacatcgtctccaacgacgattacctgctgtcc
gaaaacgtcaactcgacccattacacggcaatgacggctgacttgatgcgctcgctcgcc
aaggggaagccgtggctattgatggagcactcgacgtcagcggtcaactggcaaaaccgc
aaccaggccaagggtccgggtgagatgcgccggaactcgttgcagcacatcgctcgcggc
tccgatggcgcgctgttcttccagtggcgcgcctccaaggccggtgcggagaaataccac
tcggcgctactcccccacgccggaacgaacagtacgcggtggcgtgaagtggtcgagttc
ggcgccaacctgaaggcgttagccgcggtcgccggcagtaccgtggcgcccgcgtcaaca
gcaatcctgtacgactggaactccgtgtgggcactgaaccagaaggcccaccccagcgtt
gactattcggtgatggatcaggtgcagcgctggcatcacgagatgtaccggcgcaacgtc
ggagtcgacttcctcggccctggcgccgatctcgccggctacaagctgctcctgatcccc
gggctgtacctggtcgaccaagccaccagcgacgccgttgccgagttcgtgcgcggcggc
ggcaccgtactcgtgagctacttctccggcaccgtcgacgaaaacgaccacatttggctc
ggcggctaccccggagcattccgcgaggtcctcggagtcaccgtcgaggagttcagcccg
ctgcccgtcgacggcgcgatcgagctcaccgaattcggctccggaaccatctggtcagag
accgcccgcgccgactccgccgaggtgctcgcgcagtacgtcggcggcaatgtcactggc
tcggtagcgttgacgtgcaacagctttggcgccggaaaggcctactacgtcgggaccgaa
ttaggcgataccggacgcggtgaactcttcgaccgggtccttggcacggctggcatcgtt
tcggccgaggttgccgatggggtcgaagttgtcgtccgtcgcggcgagacggccagctgg
accttcgtcatcaaccacagcgatgcggctgccaaggtttccctgcccggacgcgacctg
ctcggcgacggaagcatccacgattcgttcgtggtgcctgccgggggtgtgagcgttctt
gagaaccctgcctaa

DBGET integrated database retrieval system