KEGG   Nakamurella sp. s14-144: EH165_00890Help
Entry
EH165_00890       CDS       T05729                                 

Gene name
pknB
Definition
(GenBank) Stk1 family PASTA domain-containing Ser/Thr kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
nak  Nakamurella sp. s14-144
Brite
KEGG Orthology (KO) [BR:nak00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nak01001]
    EH165_00890 (pknB)
Enzymes [BR:nak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     EH165_00890 (pknB)
Protein kinases [BR:nak01001]
 Serine/threonine kinases: Other
  Bacterial family
   EH165_00890 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo Pkinase_fungal RIO1 Seadorna_VP7 Kinase-like ABC1 VirB8
Motif
Other DBs
NCBI-ProteinID: AZI56940
UniProt: A0A3G8ZI98
LinkDB All DBs
Position
complement(194738..196933)
Genome map
AA seq 731 aa AA seqDB search
MTAPKIFGDRYQIGETLGFGGMSEVHRGRDLRLGRDVAIKVLRADLARDPSFQTRFRREA
QNAASLNHPAIVAVYDTGDSQGEGGLVSYIVMEYVDGQTLRDILRKEGPLPAKRAMEIMA
DVCAALDFSHRHGIVHRDVKPANIMLTKAGAVKVMDFGIARALNDSQNTMTATAAVIGTA
QYLSPEQARGEAVDARSDVYATGCVLFELLTGQPPFTGDSPVAIAYQHVREDAKAPSEVN
PAVPAELDAIVLKALNKNPLNRYQSAAEMRSDMVRALSGQAVHATPVMSNDERTELMRAT
PARVGNGAGVAAPMLAPPSRIAAVEADYVDPAAKSKRVWGFVGVGALCIAVLIAAIWVTI
SVANRPEPAQPARVPDCQNLTKEQAEAAIRDAGFTINPQDLTEEVDDAKVGLVVDQNPSP
NTLRDTSEQVQLTIGIKRALVDVPNVVSKTKEEVEKILKDGNLTPEFSDAFGPAGSLGKA
QSQDPAEGKLAPGSIVKVVIGKGPETATPPDWNTFKGKPLAEAKAAIEALGFTTAVVPRA
GVEPKDTVLEVVGDPPNVAVAKGSLATIYTSDNSLFIMPNLENQTADAASQLAIQAGWTG
GTAITKQDVETANPAQIGKVIQQNPATGTPFVKVGAINVQVGVEKKLTVPGGIVGIGAQA
AANLLASQGFTGTFTTVDRVVADPAQVGLVVSSNPTSGSVVKFNQPFAFEVGVPPAAPAT
PPSGAPPTPGG
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgacagccccgaagatcttcggtgatagataccagatcggcgaaacgctcggtttcggc
ggcatgagcgaggtacaccgcggtcgcgatctgcgtctgggccgggacgtcgccatcaaa
gtcctccgggcggatttggcgcgagacccctctttccagacgaggtttcggcgtgaagcg
cagaatgctgccagcctcaaccaccccgccatcgttgccgtctacgacaccggcgactcc
cagggcgaaggggggctcgtctcctacatcgtgatggagtacgtcgacggtcagaccttg
cgtgacatcttgcgaaaggaaggcccactcccggccaagcgcgccatggagatcatggcc
gatgtctgcgcagccctggatttctctcatcgccacggaattgtgcatcgcgacgtcaag
ccggccaacatcatgttgaccaaggcaggcgccgtcaaggtgatggacttcggtatcgcg
cgcgcgctcaacgatagtcagaacaccatgaccgccacagctgccgtcatcggtacggct
cagtacctctccccggagcaggcgcgcggcgaggctgttgatgcccggtccgatgtgtat
gccaccggctgcgtgctgttcgaactgttgacgggccaaccgccgttcaccggcgactcc
cccgtggctattgcctaccagcacgttcgcgaggacgccaaagcgcccagcgaggtcaac
cctgcggtgccggcagaactcgacgcgatcgtgctcaaagcgctgaacaagaaccccttg
aaccgctaccagagcgccgccgaaatgcggagcgacatggtgcgcgcactttccgggcaa
gccgtgcacgccacccccgtgatgagcaacgacgaacgaaccgaactcatgcgcgccacg
ccagcgcgggtaggtaacggcgccggcgtagcagcgccgatgctcgccccgccgtcccgt
atcgcggccgtggaagctgactacgtggacccggcagcaaaatctaagcgggtgtggggc
tttgtcggagtcggcgccctctgtatcgcggtgttgatcgctgcgatctgggtaaccatc
agcgtggccaaccgacccgaacccgcgcagccggcaagggttcccgattgccagaatctc
accaaggagcaggcggaggcggctattcgcgacgccgggttcaccatcaatccgcaggat
ttgaccgaagaggtcgacgacgccaaggtcggtttggtggtggaccagaaccccagcccg
aacaccctgcgcgacacctccgagcaggttcagctgaccatcggtatcaaacgtgcactc
gtcgatgtgccgaacgtcgtcagcaagaccaaagaagaagtggaaaagatcctcaaagac
gggaacctgacaccggaattcagtgatgccttcggtccggcgggctccctcgggaaggca
caaagtcaggatcctgccgagggcaaactcgcgcccggttccatcgtcaaggtggtcatc
ggtaaggggccggagacagccacccctccggactggaacacctttaagggcaagccgctc
gcggaagcgaaagcagcgatcgaagcgctcggtttcactacagcggttgttcctcgggca
ggagtcgaaccgaaggacactgtcctcgaagttgtgggggacccgccgaacgtggccgtg
gccaagggaagcctggccaccatctacacctcggacaactcgctgttcatcatgcccaac
ctcgagaaccagacggcggatgcggcaagtcagcttgcgattcaagcggggtggacaggc
ggcaccgcgataactaagcaggatgtcgagactgccaaccctgcccaaatcggcaaagtc
atccagcaaaaccccgccaccgggacgcctttcgtcaaagtgggcgccatcaacgtccaa
gtgggggtggagaagaagctcaccgtgcctggcggaatcgtcggtatcggcgcccaggct
gctgcgaatcttcttgcctcccagggcttcaccggcacgtttaccaccgtcgatagggtg
gtcgccgatccagctcaggtgggcttggtagtgagctccaaccccacttccgggtctgtc
gtgaagttcaaccaaccatttgccttcgaggtcggcgtcccgccagccgcgcctgcgacc
ccgcccagcggcgcaccgcccaccccgggaggctga

DBGET integrated database retrieval system