KEGG   Nakamurella sp. s14-144: EH165_07090Help
Entry
EH165_07090       CDS       T05729                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
nak  Nakamurella sp. s14-144
Pathway
nak03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:nak00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    EH165_07090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nak03400]
    EH165_07090
Enzymes [BR:nak01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     EH165_07090
DNA repair and recombination proteins [BR:nak03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     EH165_07090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AZI57941
UniProt: A0A3G8ZWA2
LinkDB All DBs
Position
1616976..1619624
Genome map
AA seq 882 aa AA seqDB search
MAADDVREMDGGHPMRLTHLSKVLYPKAGTTKSDVIDYVAAVASVMLPHLIGRPVTRKRW
PNGVGTDPFFTKNLERGAPGWLDRVDIEHSSRVLTYPLIDSVAGLTWLAQVGALEIHVPQ
WRSGYAHAPVAKALTEQGRTAERYPDRVVFDLDPGPGAGLPECVQVALLVRERLGALGER
MVPVTSGSKGLHLYVPMDEAITSTQASAWALQVAEQMEKALPDLVVSTMSKAIRTDRVLF
DWSQNNAAKTTIAPYSLRGREQPTVAAPRTWEELSEPGLAQLDFREVMERVAAGIDPLAT
LLDPPPGSTRRALRSQPAAARAAAAKAAAPEAAAAEAAPAETSAAADLLTEYRAKRDATK
TPEPVPMVTVGTKGGVKQGPGNTFVIQEHHASSLHWDLRLERAGVLVSWAVPKGIPVQPT
GNRLAVQTEDHPLEYARFEGTIPAKEYGGGVMTIWDSGTYETLKWRDDEVMFELMGSRVQ
GRYVLIRTSGRQWLLHRLKESSQHLAPAELAKRPHERSLPYERNSPGGRPPLAASAGEVD
HDLRPMLATAGRAEEVVDGSAWVYEGKWDGMRALAFIDNDTVTLRSRTGKDNSATFPELA
ELATLVHGHRVVLDGEIVTFDNAGRTDFGLLQQRMGLRKASDIAAAAATITVHYLIFDVL
ELDGVSLVGKKYTDRRRLLDALSIMGENCSVPGHLTGTLEEILTRTKADGWEGIIAKRTD
SHYSPGARSRAWRKVKHELQAEVLIIGWQEGQGRRAGGIGSLLLAVPKDGDGLANELRYV
GKVGTGFSDAALTSLRAQLGMLHRESPPVDISAAPSHTQDTHWVEPQLVAEVAYAEYTSS
NMLRQARWRGLRPDKSPGDVKNPDFPPRTGPATANALARNEE
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggacgacgtgcgagagatggatggtggccatccgatgaggctcacccatctc
tccaaagtcctctaccccaaggcgggcaccacaaaatcggatgtcatcgattatgtagct
gctgttgcttccgtgatgcttccgcacctgatcggtaggccggtgacacgcaagcgctgg
ccgaatggtgtggggacagaccccttcttcacgaaaaatctggaaaggggcgcacccggg
tggcttgacagggtcgacatcgaacacagctcgagggttttgacctaccccctcattgat
tcggtcgccgggctcacctggctggcccaggtcggggcgctcgaaatccatgtgccgcag
tggagaagcggatacgcccacgccccggtagccaaagccctgaccgaacaaggaagaacc
gcagaacgctatcccgatcgggtggtgtttgacctcgaccccggaccgggggcgggtctg
cccgaatgtgtgcaggtggcgttactggttcgagaacggctgggcgccttgggagaacgg
atggttccggttaccagcggtagtaaagggctacacctctacgtgccgatggacgaggcg
atcacgtcaacccaggccagcgcgtgggcattacaggtcgccgagcaaatggagaaggcg
ctcccagatctcgtagtttcgactatgtcgaaagcgattagaaccgacagggttctcttc
gattggtcgcaaaataatgctgctaaaacgaccatcgccccgtattcgctccgcggccgc
gagcaacccaccgttgccgcgccgcgcacgtgggaagagttgtccgaaccaggcctggcg
caattagattttcgcgaggtcatggaacgagtagccgccggaattgatccactggcaacg
cttctcgatcccccgccgggatcaacgcgccgcgctttgcggtcccagccagcggcagct
agggcagccgcagcgaaggcagccgcaccggaagcagccgcagcggaagcggccccagcg
gaaacatcagctgcggcagacctactgacggaatatcgcgcgaaacgcgacgcaaccaaa
acgccggaacccgtccccatggtcactgtcggcacgaaggggggcgtcaagcaggggcct
ggcaacaccttcgtcattcaagaacaccacgccagcagcctgcattgggatttgcggctg
gaacgggctggtgttctcgtgtcgtgggcagtgcccaaaggaattccggtgcaaccgacc
ggtaaccggctcgcagttcagaccgaagatcatccgctggaatacgcgaggttcgagggc
accatccccgcgaaggagtacggcggcggggtgatgacgatatgggattccggcacctac
gaaaccctcaagtggcgagatgacgaggtgatgttcgagctgatgggatctcgggttcaa
ggcaggtatgtcctgattcgcacgtcgggtcggcagtggctgctgcacagactcaaggag
tccagccaacacttggcgcctgcggaactggctaaacgcccccacgagcgaagtctcccc
tacgagcgaaatagcccagggggccgtccgccactcgcagcttctgctggtgaggtagac
cacgatctccggccgatgctggctaccgctggccgtgctgaggaggttgtggacgggagc
gcctgggtgtacgaaggcaaatgggatggcatgcgcgccttggccttcatcgacaatgac
accgtgacactgcgcagtcgcaccggcaaggacaacagtgccaccttccccgaattggca
gagctcgctactctcgtccacggacatcgggtggtgctggatggtgaaattgtcaccttc
gataatgctggccgcaccgactttggcctgctgcaacaacgaatggggctacgaaaggcc
agcgatattgcagcagcggcagccactatcaccgtccactatctgatctttgacgtgctg
gagttggatggcgtgtcgttggtcgggaagaaatacactgaccgtcgccgccttcttgat
gcactgtcaatcatgggcgagaattgctccgtgccgggccatctcaccggaacgcttgaa
gagatcttgacccgcaccaaggccgacggttgggagggcatcatcgccaaacggacggac
tcccattactcccccggagctcgctcacgagcctggcgcaaggtcaagcacgaactccaa
gccgaagtgctgattatcggatggcaggaggggcagggacgccgggcgggcggaattggt
tccctcctgctagcggtgccgaaggacggtgacggcttggctaacgagcttcgttacgtc
ggcaaggtgggcactggcttcagcgatgcggccctcacctcgctgcgggcgcagctgggc
atgttgcaccgggaatctccgccggtggatatctcagcggcgccatctcacacccaggac
acccactgggtggagcctcagcttgtcgccgaagtggcctacgctgaatacacaagtagc
aacatgctgcggcaggcaaggtggcgcggcttgcgcccggataagtctcccggtgacgtg
aagaacccggactttccaccgaggacgggacccgccactgcgaacgcgctagcccgcaac
gaggaataa

DBGET integrated database retrieval system