KEGG   Nakamurella sp. s14-144: EH165_11150Help
Entry
EH165_11150       CDS       T05729                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
nak  Nakamurella sp. s14-144
Pathway
nak00020  Citrate cycle (TCA cycle)
nak00480  Glutathione metabolism
nak01100  Metabolic pathways
nak01110  Biosynthesis of secondary metabolites
nak01120  Microbial metabolism in diverse environments
nak01130  Biosynthesis of antibiotics
nak01200  Carbon metabolism
nak01210  2-Oxocarboxylic acid metabolism
nak01230  Biosynthesis of amino acids
Module
nak_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EH165_11150
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EH165_11150
Enzymes [BR:nak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     EH165_11150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AZI58606
LinkDB All DBs
Position
complement(2510238..2511455)
Genome map
AA seq 405 aa AA seqDB search
MSKIKVVGTVVELDGDEMTRIIWQFIKDKLILPYLDINLEYYDLGIEHRDATDDQVTIDA
AHAIQKHGVGVKCATITPDEARVEEFGLKKMWVSPNGTIRNILGGVVFREPIIISNVPRL
VPGWTKPIVIGRHAHGDQYKATNFKVPTGGTVTITWTPSDGSAPVEHQVVQMPEEGGVVM
GMYNFNKSIEDFARASLNYGLLRNYPVYLSTKNTILKAYDGAFKDIFQSVFEAEFKERFD
AAGLTYEHRLIDDMVASVMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
QTVEAEAAHGTVTRHYRQHQAGKPTSTNPIASIYAWTGGLKHRGKIDGTPEVTAFAEALE
DVIIKTVESGKMTKDLAALVGPDQAWMTTEDFLAALDENLAARLS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagatcaaggtagtgggaaccgtcgtcgaactcgacggggacgaaatgacgcgg
atcatctggcagttcatcaaggacaagctgatcctgccgtacctggatatcaatcttgag
tactacgacctcggcatcgagcaccgcgacgccaccgacgaccaggtcacgatcgacgct
gcgcacgctatccaaaagcacggcgtcggcgtcaaatgcgccaccattacgcccgatgag
gcgcgggtcgaagaattcggtctcaagaagatgtgggtctcgcccaacggcaccatccgc
aacatcctcggcggcgtggtgttccgcgagccgataatcatctccaacgtgccgcgactc
gtgcccggctggaccaagccgatcgtcatcggccgccacgcgcacggcgaccagtacaag
gccacgaacttcaaggtgcccaccggcgggaccgtcacgatcacgtggaccccgagcgac
ggcagcgcgcccgtcgaacaccaggtggtccagatgcccgaagagggcggcgtcgtgatg
ggcatgtacaacttcaacaagtccatcgaagacttcgcgcgggcatcgctcaactacggc
ctgctgcgcaattacccggtgtatctatccacgaagaacacgatcctcaaggcttacgac
ggcgccttcaaggacatcttccagtccgtgttcgaggccgagttcaaggagcgtttcgac
gccgctggcctcacgtacgagcaccgcctgatcgacgacatggttgcctccgtcatgaag
tgggaaggcggatacgtctgggcctgcaagaactatgacggcgacgtccagtccgacacc
gtggcgcagggcttcggttcgctcggcctgatgacgtccgtgctgatgacgcccgatggc
cagaccgtcgaagccgaagccgcccacggcactgtgacccggcactatcgccagcaccag
gcaggcaagccgacctcgaccaacccgatcgcatcgatctacgcgtggaccggcgggctg
aagcaccgcggcaagatcgacggcacccccgaggtcacagccttcgcagaagcgctcgag
gacgtcatcatcaagaccgttgagagcggcaagatgacgaaggacctcgcggctctcgtc
ggacccgaccaagcgtggatgacgacagaggatttcctcgcggcgttggacgagaacttg
gcggcacggctttcctag

DBGET integrated database retrieval system