KEGG   Nocardiopsis alba: B005_0078Help
Entry
B005_0078         CDS       T02218                                 

Definition
(GenBank) phosphotransferase enzyme family protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
nal  Nocardiopsis alba
Brite
KEGG Orthology (KO) [BR:nal00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nal01001]
    B005_0078
Enzymes [BR:nal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     B005_0078
Protein kinases [BR:nal01001]
 Serine/threonine kinases: Other
  Bacterial family
   B005_0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Pkinase_fungal YflT Haspin_kinase Sugar_tr Kinase-like
Motif
Other DBs
NCBI-ProteinID: AFR08686
UniProt: J7L7M6
LinkDB All DBs
Position
82780..84744
Genome map
AA seq 654 aa AA seqDB search
MDMTNSDPLVGATLDRRYFVESRIAGGGMATVYVAHDLRLDRRLALKVMHPSLAQDPSFV
QRFINEAHSVAKLSHPNVVQVFDQGEDQGHVFLAMEYVPGRTLRDLLKEQGRLAPRQALN
FMAPVLAALGAAHQAGMVHRDVKPENVLITEDGRVKVADFGLARAVEQSNQGLTRTGTLM
GTAAYLAPEQIEKGTADARSDVYAAGIMLYELLTGGQPHTGETPIAIAYQHVTEDVPRPS
HFLPGLPPEVDTLVTKATERDPRYRPSNAGQYLAKVLEVLRDLPENPAPAQGRMAPVAPT
GPSAATMTAPQLIAGGAGPGTENATMVVDMGAMDGYGDDDRYPDDGERSRFGRKPLLIAG
AAVMALIVGVVGWWFLLGRFESVPDVIGSTPEAAGTEIRSSGLIYNLSDRTVYSDDAAAG
EVGGTDPEIGTRLSPGDEVTVFLSKGPQEVDMPELVGADVADAVKELEDLGFESDKIAQE
EVDATDKDPGEVISTSPEAGSTADREETVTLTVSRGIPVPSLAGEKLEDAEAQLEDLGLS
VEVVEEESENIDEGRVITQSPDTGINVGAGSTVTLTVSTGPPGVDIPNVVGERINDARKT
LEEAGFEVEVERILGGRIVAHQSHNGKAPKGTEITITATPRGINLPGDDDDDDD
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
gtggacatgacgaattccgacccgcttgtaggcgcgacactggaccgtcgctacttcgtc
gagtcaaggatcgccggtggcggcatggcgacggtgtacgtcgcccacgacctgagactg
gaccgcagactggccttgaaggtcatgcatccctctctggcccaggacccctccttcgtc
cagcgcttcatcaacgaggcgcactcggtcgccaagctctcccaccccaacgtggtgcag
gtcttcgatcagggcgaggatcagggacacgtgttcctggccatggagtacgtcccgggc
cggaccctgcgcgacctcctcaaggagcagggcaggctggccccccggcaggccctgaac
ttcatggccccggtcctggccgcgctgggcgccgcccatcaggcgggcatggtgcaccgc
gacgtcaagcccgagaacgtcctcatcaccgaggacggccgggtgaaggtcgccgacttc
ggtctggcccgcgccgtcgagcagtccaaccagggactgacccggaccggcaccctcatg
ggcaccgccgcctacctggcccccgagcagatcgagaagggcaccgccgacgcccgcagt
gacgtctacgcggccggcatcatgctctacgagctgctcaccggtggacagccgcacacc
ggcgagacccccatcgccatcgcctaccagcacgtcaccgaggacgtcccccgtccctcc
cacttcctgcccgggctcccgcccgaggtggacaccctggtcaccaaggccaccgagcgc
gatcccaggtaccgtccgagcaacgcgggccagtacctggccaaggtgctggaggtcctg
cgcgacctgccggagaaccccgccccggcccagggccggatggcgccggtcgccccgacc
ggtccctccgccgccaccatgaccgcgccccagttgatcgccggcggcgccggtccgggg
accgagaacgccaccatggtcgtcgacatgggcgccatggacggctatggcgatgacgac
cgctaccccgacgacggggagcgttcccgtttcggccgtaagcccctgctgatcgccggt
gccgcggtcatggccctgatcgtcggcgtggtcggctggtggttcctgctcggccgcttc
gagtccgttcccgacgtgatcgggtccacccctgaggccgcggggaccgagatccggtcc
agtggtctgatctacaacctctccgaccggaccgtctacagcgacgacgccgccgccggc
gaggtgggcggtaccgaccccgagatcggtacccggctctccccgggcgacgaggtgacg
gtgttcctctccaaggggccgcaggaggtggacatgcccgagctggtcggcgccgacgtc
gccgacgccgtcaaggagttggaggacctcgggttcgagtccgacaagatcgcccaggaa
gaggtcgacgccaccgacaaggaccccggcgaggtcatctccacctcacccgaggccggc
tccaccgccgaccgtgaggagacggtgacgctcaccgtcagccggggcatccccgtgccg
agcctggccggcgagaagctggaggacgccgaggcccagctggaggacctgggcctgtcg
gtcgaggtcgtcgaggaggagagcgagaacatcgacgagggccgggtgatcacccagagc
cccgacaccggcatcaacgtgggcgccggctccaccgtcaccctgaccgtctccaccggg
ccccccggagtggacatccccaacgtggtcggcgagcggatcaacgacgcccgcaagacc
ctggaggaggcgggcttcgaggtcgaggtggagcgcatcctgggcggccggatcgtggcg
caccagtcgcacaacggcaaggcgcccaagggcaccgagatcacgatcaccgcgaccccg
cgggggatcaaccttcccggtgacgacgatgatgacgacgactga

DBGET integrated database retrieval system