KEGG   Nocardiopsis alba: B005_0833Help
Entry
B005_0833         CDS       T02218                                 

Definition
(GenBank) bacterial regulatory, Fis family protein
  KO
K09684  PucR family transcriptional regulator, purine catabolism regulatory protein
Organism
nal  Nocardiopsis alba
Brite
KEGG Orthology (KO) [BR:nal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nal03000]
    B005_0833
Transcription factors [BR:nal03000]
 Prokaryotic Type
  Other transcription factors
   Others
    B005_0833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PucR HTH_30 HTH_8 GAF_3 HTH_23 HTH_28
Motif
Other DBs
NCBI-ProteinID: AFR06554
UniProt: J7L713
LinkDB All DBs
Position
complement(853877..855340)
Genome map
AA seq 487 aa AA seqDB search
MPPTLGSLLRTPRLRLRLLAGSDLLRREVEWVAVSELTDPTPYLAGGELVLTTGVRWADN
PPDLRSYVRRLAQKNVAGLGFGVEVNFDRTPEELREAAEEFGLALIEVARETPFISIGKE
VSRLLAQEEYEGLSRAFAAQRDLTRAALDGSAAVVDRLARELDARVLLLEPDGVVRHASP
ASAVDLAPDLVGELPRLRGAGPKIGASLVSGGARISLQPLATGRRVRGFLAVATREGFGS
DDRTLVNAAVSLLSLELERPALARGAGLGPGVLSALLAGALDPRHPGAEELMAGLPAEPV
LVAAARGPVPDGPPPDGVLVTTVAGTGGALALSSAAGSGHLAEALGELFDGPVGLSEPVG
YADLAVARSQAERALAAAEEEGRALLRSDELPGGLFGLLDSPAGLRLAEDLLAPIDRQRN
AAELLASLRAYLAASGRWDAAAERLGVHRHTLRYRMRRIRELLPGDLDDPDHRTELWVAL
RLREGRS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgactttgggttccctgctacggacaccgcgactgcgactgcggctgctcgcc
ggatccgacctgctgcgacgcgaggtggagtgggtcgcggtcagtgagctcaccgacccc
accccctacctggccggcggcgaactggtgctcaccaccggggtgcgctgggccgacaac
cctcccgacctgcgctcctacgtgcggagactggcacagaagaacgtcgcgggcctcggc
ttcggcgtcgaggtcaacttcgaccggacccccgaggaactgcgcgaggccgccgaggag
ttcggcctggccctgatcgaggtggcacgggagacccccttcatctcgatcggcaaggag
gtctcgcgactgctggcccaggaggagtacgaggggctgagccgcgccttcgccgcccag
cgcgatctcacccgggccgcgctggacgggtccgccgccgtggtggatcggctggcccgt
gaactcgacgcccgcgtcctgctcctcgaaccggacggcgtggtccggcacgcctcgccc
gcctcggccgtcgacctcgccccggatctggtcggagagctgccccgcctgcgcggcgcc
ggccccaagatcggagcctcattggtctcggggggcgcgcggatctcgctgcaacccctg
gccacgggccgccgggtacggggcttcctcgcggtcgccaccagggaggggttcggttcc
gacgaccgcaccctggtcaacgcggcggtgtcgctgctctccctggaactggaacggccg
gccctggcccggggcgccggcctcggcccgggtgtgctgtcggcgctgctcgccggggcc
ctggacccccgtcatccgggggctgaggagctgatggccgggctgcccgccgagccggtg
ctggtggccgcggcccgagggcccgtgcccgacgggccgccgccggacggggtcctggtc
accacggtggccgggaccgggggcgcgttggcgctctcctccgcggcggggtcgggacac
ctggccgaggcgctcggggaactcttcgacggaccggtcgggttgagcgagccggtcggg
tacgccgacctggcggtcgcccgctcccaggccgaacgggctctggccgcggcggaggag
gaggggcgcgcgctgctgcgctcggacgaacttcccggtggactgttcgggctgttggac
agcccggcggggctgcgtctggcggaggatctgctcgccccgatcgaccggcagcgcaac
gcggccgaactgttggcgtcgttgcgcgcctacctggcggcctccgggcgttgggacgcg
gcggccgaacggctgggggtgcatcggcacaccctgcgttaccggatgaggcgcatccgc
gagctgctcccgggcgatctcgacgaccccgatcatcggacggagctgtgggtggccctg
cggctgcgcgaggggcgttcctga

DBGET integrated database retrieval system