KEGG   Nocardiopsis alba: B005_1126Help
Entry
B005_1126         CDS       T02218                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
nal  Nocardiopsis alba
Pathway
nal00020  Citrate cycle (TCA cycle)
nal00480  Glutathione metabolism
nal01100  Metabolic pathways
nal01110  Biosynthesis of secondary metabolites
nal01120  Microbial metabolism in diverse environments
nal01130  Biosynthesis of antibiotics
nal01200  Carbon metabolism
nal01210  2-Oxocarboxylic acid metabolism
nal01230  Biosynthesis of amino acids
Module
nal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nal_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B005_1126
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B005_1126
Enzymes [BR:nal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     B005_1126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AFR06137
UniProt: J7L6R4
LinkDB All DBs
Position
complement(1171207..1172424)
Genome map
AA seq 405 aa AA seqDB search
MAKIKVENPVVELDGDEMTRIIWSFIKDRLILPYLDVDLKYYDLGIEERDRTDDQITVDA
ANAIKEHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVVFREPIICENVPRL
VPGWTKPVIIGRHAHGDQYKATDFKVPGPGTVTMTYTPADGSQPVEFDVAEFPEAGGVAM
GMYNYRKSIEDFARASLNYGLDRNYPVYMSTKNTILKAYDGMFKDVFEEIFEAEFKEKFA
AAGLTYEHRLIDDMVAAALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLRTADG
RTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLEHRGKLDNTPKVIEFANTLE
DVVIKTVEGGQMTKDLALLVGSEQEWLTTEQFLAALDENLSKRLA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcaaggtcgaaaaccccgtagtcgagctcgacggcgacgagatgacccgg
atcatctggtccttcatcaaggaccgtctgatcctgccctacctcgacgtcgacctgaag
tactacgacctgggcatcgaggagcgcgaccgcaccgacgaccagatcaccgtcgacgcg
gccaacgccatcaaggagcacggcgtcggcgtcaagtgcgccaccatcacgccggacgag
gcccgggtcgaggagttcggcctcaagaagatgtggcggtcgcccaacggcaccatccgc
aacatcctcggtggcgtcgtcttccgcgagcccatcatctgtgagaacgtgccgcggctg
gtgccgggctggaccaagccggtcatcatcggccgtcacgcccacggcgaccagtacaag
gccaccgacttcaaggtccccggccccggtacggtcaccatgacctacaccccggccgac
ggcagccagccggtcgagttcgacgtcgccgagttccccgaggcgggcggcgtcgccatg
ggcatgtacaactaccggaagtccatcgaggacttcgcccgggccagcctcaactacggc
ctggaccggaactacccggtctacatgtcgaccaagaacaccatcctcaaggcctacgac
ggcatgttcaaggacgtgttcgaggagatcttcgaggccgagttcaaggagaagttcgcc
gccgcgggcctcacctacgagcaccgtctcatcgacgacatggtcgccgccgcgctcaag
tgggagggcggctacgtctgggcctgcaagaactacgacggtgacgtccagtccgacacc
gtcgcgcagggcttcggctccctgggcctgatgacctccgtgctgcgcaccgccgacggc
cgtaccgtcgaggccgaggccgcccacggcaccgtgacccgtcactaccgccagcaccag
cagggcaagcccacctcgaccaacccgatcgcctccatcttcgcgtggacccgcggtctg
gagcaccggggcaagctggacaacaccccgaaggtgatcgagttcgcgaacaccctcgag
gacgtcgtcatcaagaccgtcgagggcggccagatgaccaaggacctggcgctgctggtc
ggctccgagcaggagtggctgaccaccgagcagttcctcgccgctctggacgagaacctg
agcaagcgtctcgcctag

DBGET integrated database retrieval system