KEGG   Nocardiopsis alba: B005_2061Help
Entry
B005_2061         CDS       T02218                                 

Definition
(GenBank) 2-oxoacid dehydrogenases acyltransferase family protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nal  Nocardiopsis alba
Pathway
nal00010  Glycolysis / Gluconeogenesis
nal00020  Citrate cycle (TCA cycle)
nal00620  Pyruvate metabolism
nal01100  Metabolic pathways
nal01110  Biosynthesis of secondary metabolites
nal01120  Microbial metabolism in diverse environments
nal01130  Biosynthesis of antibiotics
nal01200  Carbon metabolism
Module
nal_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B005_2061
   00020 Citrate cycle (TCA cycle)
    B005_2061
   00620 Pyruvate metabolism
    B005_2061
Enzymes [BR:nal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     B005_2061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H PYNP_C
Motif
Other DBs
NCBI-ProteinID: AFR09801
UniProt: J7LAT9
LinkDB All DBs
Position
complement(2159023..2160306)
Genome map
AA seq 427 aa AA seqDB search
MSEIHMPRLSDTMEEGVISTWVKKVGDKVAAGDVLVEIETDKAVMEFEAYEDGYLVKQNV
SEGDTVPIGEVIGLIADSPDAVPEESPAPAAPAAEEKAEEPAAEEKPAPAAPAETAPAAS
SDEAPADRPRTSPLARRLAKEYGLDITKIKGSGPKGRIVRADIEAAAKDGSAEHAAPAPE
PAAAKSAPAPAAQAFDDGRDSEELKINNVRKVIARRLTESKQTVPHFYLRRTIDAEALKA
FRGQINEQLSSTGVKISFNDLIVKACATALKLHPAVNTSWVDEKLLQHHRVNVGVAVAVD
AGLVVPVLHDTDKATLSEISTRTRELAGKARDNKLKPQEMSGGTFSVSNLGMFGVDSFSA
VINPPEAAILAVGAMRQEPVVVDGEVRVRNRISLELSVDHRAVDGAVGAAFLKDLAEILE
EPMRIIL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagatccacatgccgcgcctctccgacaccatggaggagggcgtcatctccacc
tgggtcaagaaggtgggggacaaggtcgcggccggtgacgtgctggtcgagatcgagacc
gacaaggccgtcatggagttcgaggcctacgaggacggctacctcgtcaagcagaacgtc
tccgagggcgacaccgtaccgatcggcgaggtcatcggcctcatcgccgactccccggac
gccgtacccgaggagagccccgccccggccgcccccgcggccgaggagaaggccgaggag
cccgccgccgaggagaagcccgcccccgccgctccggccgagaccgcccccgcggcctcg
tctgacgaggctccggcggaccgtccccgtacctccccgctggcccgccggctggccaag
gagtacggcctggacatcaccaagatcaagggctccggacccaagggtcggatcgtccgc
gccgacatcgaggccgccgccaaggacggctccgccgagcacgccgccccggcccccgag
ccggccgcggcgaagtccgctccggccccggccgcgcaggccttcgacgacggtcgcgac
tccgaagagctcaagatcaacaacgtgcgcaaggtgatcgcgcgccgtctgaccgagagc
aagcagacggtcccgcacttctacctgcgcaggacgatcgacgccgaggccctcaaggcc
ttccgcggccagatcaacgagcagctgtccagcaccggcgtcaagatcagcttcaacgac
ctgatcgtgaaggcctgtgccaccgcgctcaagctgcacccggccgtcaacacctcctgg
gtcgacgagaagctgctccagcaccaccgggtcaacgtcggtgtcgcggtcgccgtggac
gccggcctggtcgttccggtgctgcacgacaccgacaaggccacgctgtcggagatctcc
acccgtacgcgtgagctggccggcaaggcccgcgacaacaagctcaagccgcaggagatg
agcggcggcacgttcagcgtgtccaacctgggcatgttcggcgtggacagcttctccgcg
gtgatcaacccgccggaggccgccatcctcgcggtcggcgccatgcgccaggagcccgtg
gtcgtcgacggtgaggtgcgggtgcgcaaccgcatctcgctggagctgtccgtggaccac
cgcgcggtcgacggtgccgtcggcgccgccttcctcaaggacctcgccgagatcctcgaa
gagccgatgcgcatcatcctgtag

DBGET integrated database retrieval system