KEGG   Nocardiopsis alba: B005_2087Help
Entry
B005_2087         CDS       T02218                                 

Definition
(GenBank) aminotransferase class-III family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
nal  Nocardiopsis alba
Pathway
nal00250  Alanine, aspartate and glutamate metabolism
nal00410  beta-Alanine metabolism
nal00640  Propanoate metabolism
nal00650  Butanoate metabolism
nal01100  Metabolic pathways
nal01120  Microbial metabolism in diverse environments
Module
nal_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    B005_2087
   00650 Butanoate metabolism
    B005_2087
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B005_2087
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B005_2087
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nal01007]
    B005_2087
Enzymes [BR:nal01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     B005_2087
Amino acid related enzymes [BR:nal01007]
 Aminotransferase (transaminase)
  Class III
   B005_2087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AFR10803
UniProt: J7LAV9
LinkDB All DBs
Position
2182814..2184067
Genome map
AA seq 417 aa AA seqDB search
MAELSPVLKQATPVIAARGEGVYLYDEDDRRFLDFTAGIGVTSTGHCHPKVVAAAQEQVA
TLIHGQYTTVMHRPLLRLTERLGEVLPEGLDRLFYVNSGSEAVEAALRLARQATGRQNAV
VFQGSFHGRTMGAASLTTSGTKIRAGIGPLVPGVVVTPFPYAYRLGMSEEEAVAYALREL
DYQFATVTSPKDTAAVFIEPVLGEGGYVPVPDAFLQGLRERADQHGFLLVLDEVQTGFGR
TGTFWGHEPSGVRPDIVITAKGLASGFPISAIAAPAAIMDKAWPGSQGGTYGGNAVACAG
ALATLEVIQEEGLVENSARQGERLHQGLAKIAEAHPAIGDVRGRGLMRACEFVKADGTPD
GQSAQKAQQAAAQNGLLLLTCGPAGNVVRFIPPLIVDGDQVDTALELWAASVEETVS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcggaactctccccggttctcaagcaggcgacaccggtcatcgccgcacgaggcgag
ggtgtctacctgtacgacgaggacgaccgccgtttcctcgacttcaccgccggcatcggg
gtgaccagcacgggccactgccaccccaaggtggtcgccgccgcccaggagcaggtcgcg
accctgatccacggccagtacaccaccgtgatgcaccggcccctgctgcgactcaccgaa
cgtctcggcgaggtcctgcccgaagggctcgaccgcctgttctacgtcaactccggcagc
gaggccgtcgaagccgccctgcgcctggcacgccaggccaccgggcgtcagaacgccgtc
gtcttccagggctccttccacggacgcaccatgggcgccgcctccctcaccacctccggg
accaagatccgcgccggcatcggcccgctcgtccccggcgtcgtggtcacgcccttcccg
tacgcctaccggctcggcatgtccgaggaggaggccgtcgcctacgcgctgcgcgagctc
gactaccagttcgccacggtgacctccccgaaggacaccgcggccgtcttcatcgagccc
gtcctcggcgagggcggctacgtcccggtccccgacgccttccttcaggggctgcgcgag
cgcgccgaccagcacgggttcctgctggtcctcgacgaggtgcagaccggcttcggtcgc
accggcaccttctgggggcacgagccctccggtgtgcgtccggacatcgtcatcaccgcc
aaggggctggccagcggcttcccgatctccgccatcgccgcccccgccgcgatcatggac
aaggcctggccgggctcccagggcggcacctacggcggcaacgccgtcgcctgcgccggc
gccctcgccaccctggaggtcatccaggaggagggtctggtggagaactccgcccgccag
ggcgagcgcctccaccaggggctggccaagatcgccgaggcccaccccgccatcggcgac
gtccgaggccggggcctcatgcgggcctgcgagttcgtcaaggccgacggaacccccgac
ggccagtccgcgcagaaggcccagcaggcggccgcgcagaacggcctgctcctgctgacc
tgcggccccgccggcaacgtcgtccgcttcatcccgccgctcatcgtcgatggcgaccag
gtcgacaccgccctcgaactgtgggcggcctccgtcgaggagaccgtctcctag

DBGET integrated database retrieval system